close all open/close all

CDS information : Borre_00160


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction18,875 / 23,590 / + [in whole cluster]
18,875 / 23,590 / + [in contig]
Location18875..23590 [in whole cluster]
18875..23590 [in contig]
TypeCDS
Length4,716 bp (1,571 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)borrelidin polyketide synthase, type I
Gene
Gene (GenBank)borA2
EC number
Keyword
Note
Note (GenBank)
  • Module 1 (b-ketoacyl-ACP-synthase, acyltransferase, ketoreductase, acylcarrier protein)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
[14651102] Evidence from engineered gene fusions for the repeated use of a module in a modular polyketide synthase. (Chem Commun (Camb). , 2003)
[25188840] In vitro analysis of carboxyacyl substrate tolerance in the loading and first extension modules of borrelidin polyketide synthase. (Biochemistry. , 2014)
[26501439] Engineering a Polyketide Synthase for In Vitro Production of Adipic Acid. (ACS Synth Biol. , 2016)
[26976746] Alteration of Polyketide Stereochemistry from anti to syn by a Ketoreductase Domain Exchange in a Type I Modular Polyketide Synthase Subunit. (Biochemistry. , 2016)

close this sectionPKS/NRPS Module

1 malonyl-CoA
KS34..410
AT558..864
KR1138..1314
ACP1419..1489

close this sectionSequence

selected fasta
>polyketide synthase [borrelidin polyketide synthase, type I]
MAHEDKLRHLLKRVSAELDDTQRRVREMEESEREPIAIVGMSCRLPGGVNSPGEFWSLLE
AGTDAVSEFPRDRGWDVENLYDPDPDAPGRSYVREGGFLDGAGQFDAAFFGISPREALAM
DPQQRLLLECSWEAIERSRIDPKTLHGSRTGVFAGSNWQDYNTLLLNAEERSQSYLATGA
SGSVLSGRVSYTLGMEGPAITVNTACSSSLVAVHLAARSLRAGECDLALAGAVTVMSTPQ
LPVAFSRQRGLAPDGRSKAFAVSADGMGFGEGVGVLVLERLSVARRNGHRVLAVVRGSAV
NQDGASNGLTAPNGPSQQRVIRAALASAGLGPADVDVVEAHGTGTRLGDPIEAQALLATY
GRGRDAERPLWLGSVKSNIGHAQAAAGVAGVIKMVLAMEKGRLPRTLHVDEPSGEVDWDS
GAVRLLTEARDWPSEEGRLRRAGVSSFGISGTNAHVIIEEAPEEGEEPESDAGGVVPWVL
SARTEGALQAQAVQLSEFVGESSPVDVGWSLVSTRAAFEHRAVVVGRGRDELVRGLSEVA
QGRGVRGVASSASGGLAFVFAGQGSQRLGMGRGLYERFPVFAEAFDEVCGRVGPGVREVV
FGSDAGELDRTVWAQAGLFALEVALFRLLESWGVRPGCLIGHSVGELSAACVAGLWSLED
ACRVVAARARLMQALPAGGVMVAVRAEAGELAGFLGEDVVIASVNAPGQVVIAGPEGGVE
RVVAACGARSRRLAVSHAFHSPLVEPMLGEFRRVVESVAFGVPSLRVVSNVTGAWVDPEE
WGTPEYWVRQVREPVRFADGVATLLDAGVRTFVELGPAGALTSMVSHCADATATSVTAVP
TLRPDHDESRTVLSAAASLYVQGHPVDWAPLFPRARTVDLPTYPFQHQHYWLDVPPLFTA
SSAAQDGGWRYRIHWRRLGTRDSGDRLSGRWLLLVPESDGTEPWVEGAEKMLAERGCEVV
HVPIAATADRDAMVGAVRESVEDGRVDGVLSLLALDGRPHPDAAAVPTGLVATAQVVQVS
DELGIGPLWVATRQAVSVDGADEADGAGRTRKADDPADVAQAAVWGLGRVAALEKPRLWG
GLVDLPARADERMRDLVAQALTAPDAEDQLAVRADGIAVRRLVRSAASAPADDWQPSGTV
LVTGGTGGVGANVARWLVTQDIQHLLLVSRRGPDAPGAAELLAELSASGTSVTIEPCDVT
DADAVRRLIGAVPAERPLSTVVHAAGVLDDCLIDALTPQRLAAALEVKAKGALNLHEAAG
EAHLVLFSSLAGTTGTKGQGNYAAANAYLDALAERRRADGLPATSVAWGAWQGAGMVADA
AVAHRTRRYGLPLMSPDRAVATLRQVMAEPVATQVVADVDWQRFVADFTAVRPSRLLADL
PEVRSLGEQRKDGPGGQGEEDGLASKLAALPEADRRRAVLDLVEELVLGVLGHETRAAIG
PDSSFHAIGFDSLTAVELRNLLTVRLGMKLPATLVYDHPTLSSLADHLHEQLVIDGTPMT
DTAADLLAELDALAARLAAVGLEPEARARIGRRLKDMQTACEPRSESSRDLKSASRTEVL
DFLTNELGISR
selected fasta
>polyketide synthase [borrelidin polyketide synthase, type I]
ATGGCACATGAAGACAAACTGCGCCACCTCCTCAAGCGTGTCAGTGCTGAACTCGACGAC
ACCCAGCGCCGGGTGCGTGAGATGGAGGAGAGCGAGCGCGAGCCGATCGCGATCGTGGGG
ATGAGCTGCCGTCTGCCCGGCGGGGTGAACAGCCCGGGGGAGTTCTGGTCGCTGCTGGAG
GCCGGGACGGACGCCGTCTCGGAGTTCCCGCGGGACCGTGGCTGGGATGTGGAGAACCTC
TACGACCCGGACCCGGACGCCCCCGGGCGGTCGTACGTCCGCGAGGGCGGATTCCTGGAC
GGGGCCGGACAGTTCGACGCCGCCTTCTTCGGAATCTCGCCCCGTGAGGCGCTGGCGATG
GATCCGCAGCAGCGGCTGCTGCTGGAGTGCTCGTGGGAGGCGATCGAGCGGTCGCGGATC
GACCCGAAGACCCTGCACGGCAGCCGGACCGGCGTCTTCGCGGGCTCCAACTGGCAGGAC
TACAACACCCTGTTGCTGAACGCCGAGGAGCGCTCCCAGAGCTACCTGGCCACCGGCGCC
TCCGGAAGCGTGCTGTCCGGGCGCGTCTCGTACACGCTGGGCATGGAAGGGCCCGCGATC
ACCGTGAACACGGCGTGCTCGTCCTCTCTGGTCGCCGTCCACCTGGCGGCCCGTTCCCTG
CGGGCGGGGGAGTGCGACCTCGCCCTGGCCGGCGCCGTCACGGTCATGTCCACACCGCAG
CTTCCGGTCGCCTTCTCCCGGCAGCGCGGACTCGCCCCTGACGGTCGCTCGAAAGCCTTC
GCGGTTTCGGCCGACGGCATGGGCTTCGGCGAGGGGGTGGGCGTGCTTGTGCTGGAGCGG
TTGTCGGTGGCGCGGCGGAACGGTCATCGGGTGTTGGCGGTGGTGCGGGGTTCGGCGGTG
AACCAGGACGGTGCGTCGAACGGTCTGACGGCGCCGAACGGTCCGTCGCAGCAGCGGGTG
ATACGTGCGGCGTTGGCGAGTGCCGGGCTGGGTCCGGCCGATGTGGATGTGGTGGAGGCG
CACGGTACGGGGACGCGGTTGGGTGATCCGATCGAGGCGCAGGCGTTGCTGGCGACGTAC
GGGCGGGGCCGGGACGCGGAGCGTCCGTTGTGGCTGGGGTCGGTGAAGTCGAACATCGGT
CATGCGCAGGCTGCTGCCGGTGTCGCCGGTGTCATCAAGATGGTGCTGGCCATGGAGAAG
GGCCGTCTCCCTCGGACGCTGCATGTGGATGAGCCGTCGGGTGAGGTGGACTGGGACTCG
GGTGCGGTGCGGCTGCTGACCGAGGCGCGGGACTGGCCGTCGGAGGAAGGTCGTCTGCGG
CGGGCCGGTGTGTCGTCGTTCGGGATCTCAGGCACCAACGCGCACGTGATCATCGAGGAA
GCACCGGAAGAGGGGGAGGAACCGGAGTCCGACGCGGGTGGTGTGGTGCCGTGGGTGCTC
TCCGCGCGGACGGAAGGGGCACTGCAAGCACAGGCGGTGCAACTGAGCGAGTTCGTCGGC
GAGTCGAGTCCGGTGGATGTGGGTTGGTCGTTGGTTTCGACGCGTGCGGCGTTCGAGCAT
CGGGCCGTGGTGGTGGGGCGCGGGCGGGACGAGTTGGTGCGGGGCTTGTCCGAGGTCGCG
CAGGGTCGGGGCGTGAGGGGTGTCGCGTCTTCGGCGTCGGGTGGTCTCGCGTTTGTTTTT
GCTGGTCAGGGCAGTCAGCGGTTGGGGATGGGGCGGGGGTTGTATGAGCGGTTCCCGGTG
TTTGCCGAGGCGTTCGACGAGGTGTGTGGGCGGGTCGGTCCGGGGGTGCGGGAGGTTGTT
TTCGGTTCGGATGCGGGTGAGTTGGACCGGACGGTGTGGGCGCAGGCGGGGTTGTTCGCG
TTGGAGGTGGCGCTGTTTCGGTTGTTGGAGTCCTGGGGTGTGCGGCCGGGTTGTCTGATC
GGGCATTCGGTCGGTGAGTTGTCGGCGGCGTGTGTGGCGGGGTTGTGGTCGTTGGAGGAT
GCGTGTCGGGTCGTGGCTGCCCGGGCGCGGTTGATGCAGGCGTTGCCGGCGGGTGGGGTG
ATGGTCGCGGTTCGGGCCGAGGCGGGGGAGCTGGCCGGTTTCCTCGGTGAGGACGTGGTG
ATCGCGTCGGTGAACGCGCCGGGGCAGGTGGTGATCGCTGGTCCTGAGGGGGGTGTGGAG
CGTGTGGTGGCTGCTTGTGGGGCGCGGTCGCGTCGTCTGGCGGTCTCGCATGCTTTTCAT
TCGCCTTTGGTGGAGCCGATGCTTGGGGAGTTCCGTCGGGTTGTGGAGTCGGTGGCGTTC
GGTGTGCCGTCGTTGCGGGTGGTTTCCAATGTCACGGGTGCGTGGGTGGATCCGGAGGAG
TGGGGGACGCCGGAGTACTGGGTGCGTCAGGTCCGTGAGCCGGTGCGTTTCGCCGACGGG
GTCGCCACGTTGCTCGACGCGGGTGTGAGGACGTTCGTCGAGCTGGGTCCCGCCGGGGCG
CTCACTTCGATGGTCAGCCACTGCGCGGACGCCACCGCCACTTCGGTGACGGCTGTACCT
ACCTTGCGCCCCGATCACGATGAGTCGCGGACCGTGTTGAGTGCCGCAGCGTCCTTGTAC
GTCCAGGGTCACCCGGTCGACTGGGCCCCGCTGTTCCCGCGGGCCCGCACGGTGGACCTG
CCCACCTACCCCTTCCAGCACCAGCACTACTGGCTCGACGTACCTCCTCTGTTCACCGCC
TCCTCGGCGGCCCAGGACGGTGGCTGGCGATACCGCATCCACTGGCGGCGGCTCGGCACG
AGGGACTCCGGGGACCGGCTCTCCGGCCGCTGGTTGCTGCTGGTGCCCGAGTCGGACGGG
ACGGAGCCCTGGGTGGAGGGGGCCGAGAAGATGCTGGCCGAGCGCGGGTGCGAAGTCGTC
CACGTGCCGATCGCGGCGACGGCCGACCGGGACGCGATGGTCGGAGCCGTGCGTGAGAGC
GTCGAGGACGGTCGGGTCGACGGTGTGCTCAGCCTGCTGGCGCTCGACGGCCGCCCGCAC
CCCGATGCGGCTGCGGTGCCGACAGGGTTGGTCGCCACGGCGCAGGTTGTGCAGGTCAGT
GACGAGCTGGGCATCGGCCCGCTGTGGGTCGCCACCCGACAGGCGGTCTCCGTCGACGGG
GCCGATGAGGCTGACGGGGCCGGTAGGACCAGGAAGGCCGACGACCCCGCCGATGTCGCG
CAGGCCGCTGTGTGGGGGCTCGGCCGGGTCGCCGCGCTGGAGAAGCCTCGGTTGTGGGGC
GGCCTCGTCGACCTGCCCGCACGTGCCGACGAACGGATGCGGGACCTGGTGGCTCAGGCC
CTCACCGCTCCCGACGCCGAGGACCAACTTGCCGTGCGGGCCGACGGCATCGCCGTTCGC
CGACTGGTACGCTCCGCCGCGTCGGCCCCGGCCGACGACTGGCAGCCGAGCGGCACCGTG
CTGGTCACCGGCGGCACCGGAGGCGTCGGAGCCAACGTGGCGCGTTGGCTGGTCACCCAG
GACATCCAGCACCTGTTGCTGGTCAGCCGGCGCGGCCCGGACGCCCCCGGAGCCGCTGAG
CTGCTGGCCGAACTCAGCGCCTCAGGAACGTCCGTGACCATCGAGCCCTGCGACGTCACC
GACGCGGACGCGGTACGGCGCCTGATCGGCGCCGTACCGGCCGAACGGCCGCTGAGCACG
GTCGTCCACGCCGCGGGCGTACTGGACGACTGCTTGATCGACGCCCTGACCCCGCAGCGC
CTCGCCGCCGCACTGGAGGTCAAGGCCAAGGGCGCACTGAACCTCCACGAGGCGGCCGGG
GAAGCCCACTTGGTGCTCTTCTCCTCGCTGGCCGGAACAACCGGAACCAAGGGACAGGGC
AACTACGCCGCCGCAAACGCCTATCTCGACGCTCTGGCCGAACGGCGGCGTGCTGACGGC
CTGCCCGCCACTTCGGTCGCCTGGGGCGCCTGGCAGGGCGCGGGCATGGTGGCCGACGCC
GCCGTAGCCCACCGCACGCGCCGTTATGGCCTCCCGCTCATGAGCCCCGACCGCGCCGTC
GCCACCCTGCGGCAGGTCATGGCCGAGCCGGTGGCCACGCAGGTGGTGGCGGACGTCGAC
TGGCAGCGATTCGTCGCCGACTTCACCGCGGTGCGCCCCAGCCGCCTCCTCGCCGACCTG
CCGGAAGTGCGCTCCCTGGGCGAGCAGCGAAAGGACGGCCCGGGCGGTCAGGGCGAGGAG
GACGGCTTGGCCAGCAAGCTGGCAGCCCTGCCCGAAGCCGACCGCCGACGAGCCGTGCTG
GACCTCGTGGAGGAACTCGTCCTCGGGGTTCTGGGCCACGAGACGCGCGCGGCGATCGGC
CCGGACAGTTCCTTCCACGCCATCGGCTTCGACTCGCTCACCGCCGTCGAACTGCGCAAC
CTGCTGACCGTACGCCTCGGGATGAAGCTGCCCGCGACCCTCGTCTACGATCACCCGACC
CTGTCGTCGCTGGCCGACCACCTGCACGAGCAACTGGTTATCGACGGCACCCCCATGACG
GACACCGCGGCCGACCTGCTCGCCGAACTCGACGCACTCGCGGCGAGACTCGCCGCCGTC
GGGCTGGAACCGGAGGCGCGCGCCCGCATCGGACGCAGGCTCAAGGACATGCAGACCGCC
TGCGAACCCAGGTCGGAGTCCTCACGCGACCTGAAGTCCGCCTCACGCACCGAAGTGCTC
GACTTCCTCACCAACGAACTCGGCATCTCCCGCTGA
[1] KS34..410
[1] AT558..864
[1] malonyl-CoA737..741
[1] KR1138..1314
[1] ACP1419..1489
[1] KS100..1230
[1] AT1672..2592
[1] malonyl-CoA2209..2223
[1] KR3412..3942
[1] ACP4255..4467

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [550-675]  1.9e-80 G3DSA:3.40.366.10 [737-855]  1.9e-80 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1447-1462]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1410-1496]  3.0999994589937e-20 SSF47336
SSF47336   ACP_like
 [1419-1489]  PS50075
PS50075   ACP_DOMAIN
 [1416-1492]  2.4e-20 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1423-1488]  7.20000000000001e-12 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [1138-1313]  4.30000000000003e-58 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-283]  2.39999999999997e-98 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-410]  1.40000000000001e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [558-864]  4.80000000000003e-62 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  3e-08 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [555-847]  6.19996040581186e-74 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [677-736]  1.09999909120787e-12 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [36-296]  5.20000000000001e-94 G3DSA:3.40.47.10 [297-464]  7.69999999999997e-67 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-463]  8.89993011983204e-108 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1139-1340]  1.09999999999999e-39 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [559-846]  1.59998835313644e-114 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1420-1492]  7.40000780398343e-27 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-463]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1138-1314]  1.79999754022375e-45 SM00822
SM00822   PKS_KR
SignalP
 [1-16]  0.079 Signal
Eukaryota   
TMHMM No significant hit