close all open/close all

CDS information : Borre_00170


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction23,686 / 34,188 / + [in whole cluster]
23,686 / 34,188 / + [in contig]
Location23686..34188 [in whole cluster]
23686..34188 [in contig]
TypeCDS
Length10,503 bp (3,500 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)borrelidin polyketide synthase, type I
Gene
Gene (GenBank)borA3
EC number
Keyword
Note
Note (GenBank)
  • Module 2 (b-ketoacyl-ACP-synthase, acyltransferase, dehydratase, ketoreductase, acylcarrier protein) and Module 3 (b-ketoacyl-ACP-synthase, acyltransferase, dehydratase, ketoreductase, acylcarrier protein)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
[14651102] Evidence from engineered gene fusions for the repeated use of a module in a modular polyketide synthase. (Chem Commun (Camb). , 2003)
[21472957] Stereoselectivity of isolated dehydratase domains of the borrelidin polyketide synthase: implications for cis double bond formation. (Chembiochem. , 2011)
[26501439] Engineering a Polyketide Synthase for In Vitro Production of Adipic Acid. (ACS Synth Biol. , 2016)

close this sectionPKS/NRPS Module

2 malonyl-CoA
3 methylmalonyl-CoA
KS34..410
AT560..866
DH913..1076
KR1356..1529
ACP1628..1698
KS1724..2100
AT2245..2555
DH2603..2760
KR3062..3242
ACP3336..3410

close this sectionSequence

selected fasta
>polyketide synthase [borrelidin polyketide synthase, type I]
MPNDEELLDYLKRTASNLQEARQRVHELEESEREPIAIVGMSCRLPGGVNSPEEFWSLLE
AGTDAVSEFPRDRGWDVERLYDPDPDAPGKSYVREGGFLDGAGRFDPAFFGISPREAVVM
DPQQRLLLECSWEAIERSRIDPKTLHGSRAGVFVGSNGQDYGTLLLRADDRSHAYLATGA
SASVLSGRISYTLGLEGPAVTISTACSSSLVALHLAARALRAGECELALAGGVTVMPTTR
LFEVFSRQRGLAGDGRCKAFAAGADGTGWGEGVGVLVLERLSVARRNGHRVLAVVRGSAV
NQDGASNGLTAPNGPSQQRVIRAALASARLAPEDVDAVEAHGTGTSLGDPIEAQALLATY
GRGRDAERPLWLGSVKSNIGHAQAAAGVAGVIKMVKAMQAGTLPRTLHVDEPSGEVDWDS
GAVRLLTEARDWPSEEGRLRRAGVSSFGISGTNAHVILEEPPAEDAVPEPEAGDVVPWVL
SARSAEALREQAARLASVAGGLNVVDVGWSLASTRAAFEHRAVVVGREREELLAGLFAVA
AGRPAANVVTGPVSSGRPAFVFAGQGSQRLGMGRGLYERFPVFAEAFDEVCGRVGPGVRE
VVFGSDAGELDRTVWAQAGLFALEVALFRLLESWGVRPGCLIGHSVGELSAACVAGLWSL
EDACRVVAARARLMQALPAGGVMVAVRAEAGELAGFLGEDVVIASVNAPGQVVIAGPEGG
VERVVAACGARSRRLAVSHAFHSPLVEPMLGEFRRVVESVAFGVPSLRVVSNVTGAWVDP
EEWGTPEYWVRQVREPVRFADGVATLLDAGVRTFVELGPAGTLTSMVSHCADATATSVTA
VPTLRPDHDESRTVLSAAASLYVQGHPVDWAPLFPRARTVDLPTYPFQHQHYWMMNTGSA
AEPAELGLGDARHPLLGSVVTVAGDDKVVFAGRLALRTHPWLADHTVLDAVLLPATAFLE
LAVRAGEEVSCPVVHDLTLHRPLVVPERGAVQVQMAVGAPEADGRREVRVYSRPDDDAEH
EWTLHAAGLLASAATAEPAVAAGAWPPPEAQAVDLDGFYAGLAEHGYHYGPLFQGVRAAW
RLGDDVLAEIVLPEAAGADAARYGMHPALLDAVLHAARLGAFRERSEEKYLPFAWEGVTL
RTRGATAVRARISRAGTDAIRLDVTDTADRPVLTAESLTLRPVSAGQLMAVPRDSLFRVD
WVSAPAANGPGLRLARAATVEAALAADADIVVVPCLDSEGPHQATYQALELLQRWLAADT
GTTTLALLTHRAVAVGDDVHDLHHAPLWGLVRTAQTEHPGCFRLVDSDDPDPTTDVLAAA
LATGEPQVAIRDGAVLAPRLTAASAPREPAEWDAEGTVLITGGSGALAGIVAQHLVARHG
VRRLVLASRSGRPAPGADLLDADVTAVSCDVSDRDAVAALLASVPDEHPLTAVVHTAGVL
DDGVLHALTTERIDTSFAAKVDGARHLHELTSHLDLTAFVLFSSASAVLGAAGQGNYAAA
NAYLDALAAHRRSNDLPAVSLAWGLWAEHEGMARGLGDAELTRISRIGVTALSAEDGMRL
FDAGCAGDQSQLVPMRVDTAALRARRDHLPAPMWSLVPERTRAARTQPAASLRDRLAELT
APERKRTVLNLVRNAVADTLGHNAADGVPPDQSLDAAGFDSLTAVEFRNRLSAVTDLRLP
ATLTYDHPTPAAIAEHILTRLTLLKETAAPAVGTAPVAAPTEDDAIVIVGMAGRFPGGVR
TPEGLWDLVHSGTDAISEWPTDRGWDVENLYDPDPDAVGKSYVRHGGFLHDVAGFDAGFF
GISPREALAMDPQQRLLLECSYEALERAGIDPATLRGSRSGVYAGVMYHEYASRLGATPA
GFEGTLGTGSSGSIASGRISYTFDLTGPAVTVDTACSTSLVGLHLAVQALRAGECELALA
GGVTVMHTPRPFVEFSRQRGLAADGRSKAFAASADGVAWAEGAGILVLERLSAARRNGHR
VLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRAALASAGLGPADVDVVEAHGTGTALGDP
IEAQALLATYGRGRDADRPLWLGSVKSNIGHTQAAAGVASVIKMVQAMQAGVLPRTLHVD
EPSGEVDWDSGAVRLLTEAREWPSGEGRVRRAGVSSFGISGTNAHVILEEPPAEDALPEP
EAGDVVPWVLSARSAEALREQAARLASVAGGLNVVDVGWSLASTRAAFEHRAVVVGGDRE
ELLGKLSSVSGVEVGVGVGAGGGVVLVFAGQGCQWVGMGRELLGSSLVFAESMRECAAAL
SPFVDFSVVDVLGSAGELGRVEVVQPALWAVMVSLARVWRSWGVPVAAVVGHSQGEIAAA
TVAGALSVGDAARVVALRSRLIAERLSGLGGMVSVALSRERVVSLIAGVPGVSVAAVNGS
SSTVVSGEAAGLERVLAACVSSGVRARRIDVDYASHSVQVELIREELLGVLDGIVPRSGE
IPFVSTVTGERIDTVELGAEYWYRNLRQTVEFQSVVEGLVAQGCRVFLESSPHPVLTVGI
EESADRVVALESLRRGEGGLRRLVDAAGEAWVRGVPIDWAGMLAGGRRVDLPTYPFQHQP
YWLDSPRHPAGDVTAVGLTEAGHAFVPAAVDLPDGQRVWTGRLSLPSYPWLADHQVLGQV
LLPGVVWVELALHAGHQAGCDSVDELTLQSPLVLGASDTVQVRVVVTETEEPGTRTVSMH
SRRDDGSWVTHAEGILGAGGPPPEPLPEWPPTGAMPLDVEGFYDELAAGGYHYGPQFRCL
RRAWRAGEDLVAEISLPEGTDVDAYGLHPGLFDAAVHSVACARTSAGAGDDGPRLPFAFS
DVRLFATGVTSLRVRIDPQNSSWQAWDESGLPVLTIGRLAGRPVDADQFAVRRAGHLFRV
ETRHEALAGPAPASWAVIGADPAGYAAALEATGAQVTTAADLAGLTSAPEAALFTLPGTK
DAGVTEEVPTAVREATAQVLEVLQDWLTDGRFDDARLVVVSREAEDGDLLHGTARGLLRA
AQAEHPDRITLVDLDAHPASLTALPGFALGPEPEVVVRAGDGRAPRLARAQAPTGAGSLG
TGTVLITGGTGTLGGLLARHLVETHGVTRLLLVSRRGPAADGADRLHAELTGHGAHVDIV
AADLGDRTSVAALLATVDADHPLSAVVHAAGALDDGVLGTRSADWLDPVLRPKADAAWHL
HELTAELPLTAFVMFSSAASVLGAAGQANYAAANGFLDALAAHRAARGLPGTSLAWGLWE
HRSELTRHTGSPSRSIAAVGALSTAEALAAFDAGLASGEPLAVPIRLESTSSEEVPPMLR
GLVRVRRRAATGTEPAASAGAAQEVRQLAELGADERQRRVQRIVLDTAAAVLGHDSHDAI
PLTRGFLELGFDSLTAVRLRNRLARRLGLRLPATVVFDHPSPAALAAHLVEHLVGTVDPT
AQAMEQLEALRRSVHAATPAGGLDRALVTQRLTALLDEMRHVDGPGGTEGPDGSGDDLEN
ATADEIYALIDNELGIGGTQ
selected fasta
>polyketide synthase [borrelidin polyketide synthase, type I]
ATGCCCAACGACGAAGAACTCCTCGACTACCTGAAGCGGACTGCCTCGAACCTCCAGGAG
GCGCGGCAGCGGGTGCACGAACTGGAGGAGAGCGAGCGCGAGCCGATCGCGATCGTGGGG
ATGAGCTGCCGTCTGCCCGGCGGGGTGAACAGCCCGGAAGAGTTCTGGTCGCTGCTGGAG
GCCGGGACGGACGCCGTCTCGGAGTTCCCGCGGGACCGTGGCTGGGACGTGGAGCGGCTG
TACGACCCGGACCCGGACGCCCCCGGCAAGTCGTACGTGCGGGAAGGCGGATTCCTCGAC
GGCGCGGGCCGGTTCGACCCCGCGTTCTTCGGTATCTCCCCGCGGGAGGCCGTGGTCATG
GATCCGCAGCAGCGGCTGCTGCTGGAGTGCTCGTGGGAGGCGATCGAGCGGTCGCGGATC
GACCCGAAGACCCTGCACGGCAGCCGCGCGGGCGTGTTCGTGGGCTCGAACGGCCAGGAC
TACGGGACGCTTCTCCTGCGTGCCGACGACCGCTCCCACGCCTACCTCGCCACGGGCGCC
TCCGCGAGCGTGCTCTCCGGCCGCATCTCCTACACGCTCGGACTGGAGGGCCCTGCGGTC
ACGATCAGTACGGCCTGCTCGTCCTCACTGGTCGCCCTCCACCTGGCGGCCCGCGCCCTG
CGGGCGGGGGAGTGCGAGCTGGCGCTCGCCGGCGGTGTGACGGTCATGCCGACGACCCGC
CTGTTCGAGGTCTTCTCCCGGCAGCGTGGCCTGGCCGGTGACGGCCGCTGCAAGGCCTTC
GCGGCCGGGGCCGACGGCACTGGCTGGGGCGAGGGCGTGGGCGTACTCGTCCTGGAGCGG
TTGTCGGTGGCGCGGCGGAACGGTCATCGGGTGTTGGCGGTGGTGCGGGGTTCGGCGGTG
AACCAGGACGGTGCGTCGAACGGTCTGACGGCGCCGAACGGTCCGTCGCAGCAGCGGGTG
ATCCGCGCGGCCTTGGCCAGTGCACGCCTGGCCCCCGAGGACGTGGACGCCGTAGAGGCA
CACGGCACGGGGACCTCCCTGGGCGACCCGATCGAGGCGCAGGCGTTGCTGGCGACGTAC
GGGCGGGGCCGGGACGCGGAGCGTCCGTTGTGGCTGGGGTCGGTGAAGTCGAACATCGGT
CACGCGCAGGCCGCTGCCGGTGTCGCCGGTGTCATCAAGATGGTCAAGGCGATGCAGGCG
GGCACGCTGCCCCGGACGCTGCATGTGGATGAGCCGTCGGGTGAGGTGGACTGGGACTCG
GGTGCGGTGCGGCTGCTGACCGAGGCGCGGGACTGGCCGTCGGAGGAAGGTCGTCTGCGG
CGGGCCGGTGTGTCGTCGTTCGGGATCTCCGGCACCAACGCGCACGTGATTCTCGAGGAG
CCGCCGGCGGAGGACGCGGTACCGGAGCCTGAAGCGGGTGATGTGGTGCCGTGGGTTCTT
TCGGCGCGGTCGGCTGAGGCGTTGCGGGAGCAGGCTGCCCGGCTGGCGTCGGTGGCTGGT
GGGTTGAACGTGGTGGATGTGGGCTGGTCGTTGGCTTCGACGCGTGCGGCGTTCGAGCAC
CGGGCCGTAGTGGTGGGGCGGGAGCGGGAAGAGCTGCTCGCGGGTCTGTTCGCTGTGGCT
GCGGGACGCCCGGCTGCGAACGTGGTGACGGGGCCCGTCAGCTCCGGTCGGCCCGCCTTT
GTTTTTGCTGGTCAGGGCAGTCAGCGGTTGGGGATGGGGCGGGGGTTGTATGAGCGGTTC
CCGGTGTTTGCCGAGGCGTTCGACGAGGTGTGTGGGCGGGTCGGTCCGGGGGTGCGGGAG
GTTGTTTTCGGTTCGGATGCGGGTGAGTTGGACCGGACGGTGTGGGCGCAGGCGGGGTTG
TTCGCGTTGGAGGTGGCGCTGTTTCGGTTGTTGGAGTCCTGGGGTGTGCGGCCGGGTTGT
CTGATCGGGCATTCGGTCGGTGAGTTGTCGGCGGCGTGTGTGGCGGGGTTGTGGTCGTTG
GAGGATGCGTGTCGGGTCGTGGCTGCCCGGGCGCGGTTGATGCAGGCGTTGCCGGCGGGT
GGGGTGATGGTCGCGGTTCGGGCCGAGGCGGGGGAGCTGGCCGGTTTCCTCGGTGAGGAC
GTGGTGATCGCGTCGGTGAACGCGCCGGGGCAGGTGGTGATCGCTGGTCCTGAGGGGGGT
GTGGAGCGTGTGGTGGCTGCTTGTGGGGCGCGGTCGCGTCGTCTGGCGGTCTCGCATGCT
TTTCATTCGCCTTTGGTGGAGCCGATGCTTGGGGAGTTCCGTCGGGTTGTGGAGTCGGTG
GCGTTCGGTGTGCCGTCGTTGCGGGTGGTTTCCAATGTCACGGGTGCGTGGGTGGATCCG
GAGGAGTGGGGGACGCCGGAGTACTGGGTGCGTCAGGTCCGTGAGCCGGTGCGTTTCGCC
GACGGGGTCGCCACGTTGCTCGACGCGGGTGTGAGGACGTTCGTCGAGCTGGGTCCCGCT
GGGACGCTCACTTCGATGGTCAGCCACTGCGCGGACGCCACCGCCACTTCGGTGACGGCT
GTACCTACCTTGCGCCCCGATCACGATGAGTCGCGGACCGTGTTGAGTGCCGCAGCGTCC
TTGTACGTCCAGGGTCACCCGGTCGACTGGGCCCCGCTGTTCCCGCGGGCCCGCACGGTG
GACCTGCCCACCTACCCCTTCCAGCACCAGCACTACTGGATGATGAACACCGGAAGTGCC
GCCGAGCCGGCGGAGCTGGGGCTCGGCGATGCCCGTCATCCGCTGCTCGGTTCCGTCGTC
ACCGTCGCGGGGGACGACAAGGTCGTCTTCGCCGGGCGGCTGGCGCTGCGCACACACCCC
TGGCTGGCCGACCACACCGTGCTCGACGCGGTCTTGCTGCCCGCTACGGCCTTCCTCGAA
CTGGCCGTGCGCGCCGGTGAGGAGGTGAGCTGTCCGGTCGTACACGACCTGACGCTGCAC
CGACCGCTGGTCGTACCCGAGCGGGGCGCCGTGCAGGTACAGATGGCTGTGGGCGCACCG
GAAGCCGATGGGCGACGTGAGGTCCGGGTGTACTCCCGCCCCGACGACGACGCGGAGCAC
GAGTGGACGCTGCACGCCGCTGGACTGCTGGCGTCGGCCGCCACGGCGGAGCCCGCCGTG
GCGGCCGGTGCCTGGCCGCCGCCGGAGGCGCAGGCCGTGGACCTCGACGGCTTCTACGCC
GGACTCGCCGAGCACGGCTACCACTACGGCCCGCTGTTCCAGGGCGTCCGGGCCGCGTGG
CGGCTGGGCGACGACGTTCTCGCCGAGATCGTGCTGCCCGAGGCGGCCGGCGCCGACGCC
GCCCGGTACGGCATGCATCCGGCCCTGCTCGACGCCGTCCTGCACGCGGCACGGCTGGGC
GCCTTCCGTGAGCGGTCGGAGGAGAAGTACCTGCCGTTCGCCTGGGAAGGCGTGACCCTG
CGTACCAGGGGAGCGACCGCCGTACGTGCTCGAATCTCCCGGGCCGGTACCGACGCCATC
CGGCTGGACGTCACCGACACCGCGGACCGGCCGGTCCTCACGGCCGAATCGCTCACGCTG
CGACCGGTCTCCGCCGGTCAGCTCATGGCCGTCCCGCGCGACTCACTGTTCCGGGTCGAC
TGGGTTTCCGCGCCCGCCGCGAACGGTCCCGGCCTGCGGCTGGCCCGTGCCGCCACCGTG
GAGGCGGCCCTCGCGGCGGACGCCGACATCGTGGTCGTGCCATGCCTCGACAGTGAGGGT
CCGCATCAGGCGACGTACCAGGCACTGGAGCTGCTACAGCGCTGGCTGGCCGCCGACACC
GGTACCACCACGCTCGCCCTGCTCACCCACCGTGCCGTGGCGGTCGGCGACGACGTCCAC
GACCTCCACCACGCGCCTCTGTGGGGCCTGGTCCGCACCGCCCAGACCGAACACCCCGGC
TGCTTCCGGCTCGTCGACTCGGACGACCCCGACCCGACGACGGACGTCCTGGCCGCGGCG
CTCGCCACCGGGGAACCCCAGGTCGCGATCCGTGACGGCGCCGTCCTGGCCCCGCGGCTG
ACCGCGGCCTCCGCGCCGCGGGAGCCGGCCGAGTGGGACGCCGAGGGAACAGTCCTCATC
ACCGGCGGATCGGGCGCCCTCGCAGGGATCGTGGCCCAGCACCTCGTCGCACGTCACGGC
GTACGCCGACTCGTCCTCGCGAGCCGCAGCGGCAGGCCCGCACCGGGGGCCGACCTGCTC
GACGCCGACGTCACGGCCGTGTCCTGCGACGTCTCCGACCGCGACGCCGTGGCCGCGCTG
CTCGCCTCCGTGCCGGACGAACACCCGCTCACCGCCGTCGTGCACACCGCAGGCGTACTG
GACGACGGCGTCCTGCACGCCCTCACGACCGAGCGCATCGACACCTCGTTCGCGGCGAAG
GTCGACGGCGCCCGTCATCTCCACGAACTCACCTCCCACCTGGATCTCACCGCGTTCGTG
CTGTTCTCCTCCGCGTCGGCCGTGCTGGGCGCCGCCGGACAGGGCAACTACGCCGCGGCC
AACGCCTACCTCGACGCGCTCGCCGCCCACCGTCGCAGCAACGACCTGCCCGCCGTGTCT
CTCGCGTGGGGGCTGTGGGCCGAGCACGAGGGCATGGCCCGCGGACTCGGTGACGCCGAG
CTGACGCGTATTTCCCGGATCGGCGTCACCGCGCTGAGCGCGGAGGACGGCATGCGGCTG
TTCGACGCCGGATGCGCCGGCGATCAGTCACAGCTCGTGCCGATGCGGGTGGACACCGCG
GCGCTGCGCGCACGGCGTGACCACCTTCCCGCACCGATGTGGAGCCTGGTCCCCGAGCGG
ACCCGAGCGGCACGTACACAGCCTGCCGCCTCGCTTCGGGACAGGCTCGCCGAACTGACC
GCCCCCGAACGCAAGCGCACGGTCCTCAACCTGGTGCGCAACGCGGTCGCCGACACACTC
GGCCACAACGCCGCCGACGGAGTACCGCCCGACCAGAGCCTCGACGCCGCCGGGTTCGAC
TCGCTCACCGCCGTCGAGTTCCGCAACCGGCTCTCCGCCGTCACCGACCTGCGCCTGCCC
GCCACCCTCACCTACGATCACCCCACCCCCGCGGCCATCGCCGAGCACATCCTGACCCGC
CTCACCCTGCTGAAGGAGACCGCCGCCCCGGCCGTCGGCACCGCCCCGGTTGCGGCGCCG
ACCGAAGACGATGCGATCGTCATCGTGGGCATGGCGGGCCGCTTCCCTGGCGGCGTGCGC
ACACCCGAAGGTCTTTGGGACCTCGTCCACTCCGGCACGGACGCCATCTCGGAGTGGCCC
ACCGACCGCGGCTGGGACGTGGAGAACCTCTACGACCCGGACCCCGACGCCGTCGGCAAG
TCCTACGTACGGCACGGCGGATTCCTGCACGACGTCGCCGGCTTCGACGCGGGCTTCTTC
GGGATCTCGCCGCGTGAGGCGCTGGCGATGGACCCGCAGCAGCGGCTCCTGCTGGAGTGC
TCGTACGAGGCCCTGGAGCGGGCGGGCATCGACCCGGCCACGCTCAGAGGCAGCCGGTCG
GGCGTGTACGCCGGAGTGATGTACCACGAGTACGCCTCCCGGCTGGGCGCCACGCCCGCA
GGCTTCGAAGGCACACTCGGCACCGGAAGCTCGGGCAGCATCGCCTCCGGGCGCATCTCC
TACACATTCGACCTCACCGGGCCCGCGGTCACCGTCGACACCGCATGTTCCACCTCCCTC
GTAGGCCTGCACCTGGCCGTGCAGGCTCTGCGGGCCGGTGAGTGCGAACTGGCCCTCGCC
GGCGGCGTCACCGTCATGCACACGCCGCGCCCCTTCGTCGAGTTCTCCCGCCAGCGCGGC
CTGGCCGCGGACGGCCGGAGCAAGGCCTTCGCGGCCTCCGCCGACGGGGTGGCCTGGGCC
GAAGGCGCCGGAATCCTCGTCCTGGAGCGGCTGTCGGCGGCGCGGCGGAACGGTCATCGG
GTGTTGGCGGTGGTGCGGGGTTCGGCGGTGAACCAGGACGGTGCGTCGAACGGTCTGACG
GCGCCGAACGGTCCGTCGCAGCAGCGGGTGATACGTGCGGCCTTGGCGAGTGCCGGGCTG
GGTCCGGCCGATGTGGATGTCGTCGAGGCCCACGGCACCGGCACGGCCCTCGGCGATCCG
ATCGAGGCGCAGGCGTTGCTGGCGACGTACGGGCGGGGGCGTGACGCGGATCGTCCGTTG
TGGCTGGGGTCGGTGAAGTCGAACATCGGTCACACGCAGGCGGCCGCGGGTGTGGCAAGC
GTGATCAAGATGGTGCAGGCGATGCAGGCGGGCGTGCTGCCGCGGACGCTGCATGTGGAC
GAGCCGTCGGGTGAGGTGGATTGGGACTCGGGTGCGGTGCGGCTGCTGACCGAGGCGCGC
GAGTGGCCGTCGGGGGAGGGGCGTGTGCGGCGGGCGGGTGTGTCGTCGTTCGGGATCTCC
GGGACGAACGCGCACGTGATCCTTGAGGAGCCGCCGGCGGAGGACGCGCTGCCGGAGCCT
GAAGCGGGTGATGTGGTGCCGTGGGTTCTTTCGGCGCGGTCGGCAGAGGCGTTGCGGGAG
CAGGCTGCCCGGCTGGCGTCGGTGGCTGGTGGGTTGAACGTGGTGGATGTGGGCTGGTCG
TTGGCTTCGACGCGTGCGGCGTTCGAGCACCGGGCCGTCGTCGTGGGAGGCGATCGGGAA
GAGCTCCTGGGGAAGCTTTCCTCGGTTTCGGGGGTCGAGGTCGGGGTCGGGGTCGGTGCC
GGTGGTGGTGTGGTGTTGGTGTTCGCCGGTCAGGGGTGTCAGTGGGTCGGTATGGGGCGG
GAGTTGCTGGGTTCCTCGCTGGTGTTCGCGGAGTCGATGCGGGAGTGCGCGGCGGCTCTG
TCGCCGTTTGTGGACTTTTCTGTGGTGGATGTTCTGGGTTCGGCTGGGGAGTTGGGTCGG
GTCGAGGTGGTTCAGCCTGCGTTGTGGGCGGTGATGGTGTCGCTGGCGCGGGTGTGGCGG
TCGTGGGGTGTTCCGGTTGCTGCGGTGGTGGGTCATTCGCAGGGTGAGATTGCCGCGGCG
ACGGTGGCGGGTGCGTTGAGTGTGGGTGATGCGGCGCGGGTGGTGGCGTTGCGGAGCCGT
TTGATCGCGGAGCGTCTGTCGGGGCTGGGTGGGATGGTTTCGGTGGCGTTGTCGCGTGAG
CGGGTGGTGTCGTTGATCGCGGGTGTGCCGGGTGTGTCGGTGGCGGCGGTGAACGGTTCT
TCGTCGACGGTGGTCTCGGGTGAGGCCGCGGGGCTGGAGAGGGTGCTGGCCGCGTGTGTG
TCGTCGGGGGTTCGGGCGCGTCGTATCGATGTGGATTACGCCTCGCATTCGGTGCAGGTG
GAGTTGATCCGTGAGGAGTTGTTGGGGGTTCTGGACGGGATCGTCCCGCGCTCGGGTGAG
ATTCCGTTCGTGTCCACGGTGACGGGTGAGCGGATCGACACTGTCGAGCTGGGGGCGGAG
TACTGGTACCGCAATCTCCGTCAGACAGTGGAATTCCAGTCGGTGGTGGAGGGTCTGGTC
GCTCAGGGGTGTCGGGTGTTCCTGGAGTCCAGTCCGCATCCGGTGTTGACGGTCGGCATC
GAGGAGTCCGCGGATCGGGTCGTGGCGTTGGAGTCGCTGCGTCGTGGCGAGGGTGGTCTG
CGGCGGTTGGTGGATGCGGCCGGTGAGGCGTGGGTGCGTGGGGTGCCGATCGACTGGGCG
GGGATGCTCGCCGGCGGCCGGCGGGTCGACCTGCCCACCTATCCCTTCCAACACCAGCCC
TACTGGCTCGACTCACCACGACACCCTGCCGGAGACGTGACCGCCGTCGGTCTCACAGAG
GCCGGTCACGCGTTCGTGCCGGCGGCGGTCGACCTGCCGGACGGGCAGCGGGTCTGGACG
GGACGACTGTCGCTTCCCTCCTACCCGTGGCTGGCCGATCATCAGGTGCTCGGGCAGGTG
CTGCTCCCCGGCGTGGTCTGGGTCGAACTCGCCCTGCACGCGGGGCACCAGGCCGGATGC
GACTCTGTCGATGAGCTCACCCTACAGTCGCCGCTCGTGCTCGGTGCGTCCGACACCGTA
CAGGTGAGGGTCGTCGTCACGGAGACCGAAGAGCCCGGCACCCGCACCGTGTCGATGCAC
TCGCGCCGTGACGACGGCAGCTGGGTGACTCACGCCGAGGGGATCCTCGGGGCGGGCGGG
CCGCCGCCGGAGCCGCTGCCGGAATGGCCGCCGACCGGCGCCATGCCCCTCGATGTCGAG
GGCTTCTACGACGAGCTCGCGGCGGGCGGCTACCACTACGGGCCTCAGTTCCGCTGCCTG
CGGCGCGCCTGGCGTGCCGGTGAGGATCTCGTCGCCGAGATCTCGCTGCCGGAGGGCACC
GACGTCGATGCGTACGGCCTGCACCCTGGACTCTTCGACGCGGCGGTGCACAGCGTGGCC
TGCGCCCGGACGAGCGCGGGGGCCGGCGATGACGGTCCCCGGCTGCCGTTCGCCTTCTCG
GACGTCCGGCTCTTCGCGACCGGGGTGACCTCGCTACGGGTCCGGATCGATCCGCAGAAC
TCCTCGTGGCAGGCGTGGGACGAATCCGGGCTGCCGGTCCTCACCATCGGGCGGCTCGCC
GGCCGGCCTGTCGACGCCGATCAGTTCGCCGTGCGGCGGGCGGGCCACCTCTTCCGCGTC
GAAACGCGGCACGAAGCCCTGGCCGGCCCGGCCCCCGCCTCCTGGGCGGTCATCGGAGCG
GACCCGGCCGGGTACGCCGCAGCCCTGGAGGCCACGGGCGCGCAGGTGACGACGGCTGCC
GACCTGGCCGGTCTCACATCGGCACCCGAAGCCGCCCTGTTCACGCTCCCCGGCACAAAG
GACGCGGGGGTCACCGAGGAGGTGCCGACCGCTGTCCGGGAGGCGACCGCTCAGGTGCTG
GAGGTGCTGCAGGACTGGCTCACCGACGGACGTTTCGACGATGCCCGACTGGTCGTCGTA
AGCCGCGAAGCGGAAGACGGCGATCTCCTCCACGGAACGGCGCGCGGACTGCTGCGCGCC
GCACAGGCCGAGCACCCGGACCGCATCACCCTTGTCGACCTCGATGCTCATCCCGCCTCG
CTCACGGCCCTTCCCGGTTTCGCCCTCGGTCCCGAACCGGAGGTCGTCGTACGCGCGGGA
GACGGCAGGGCACCGCGCCTGGCCCGGGCGCAGGCCCCCACCGGAGCGGGCTCACTGGGC
ACGGGCACGGTCCTGATCACCGGAGGCACGGGCACCCTCGGGGGACTGCTCGCCCGGCAC
CTGGTGGAGACGCACGGAGTCACCCGGCTGCTGCTGGTCAGCCGACGAGGACCGGCCGCC
GACGGCGCGGACCGGCTGCACGCCGAGCTCACCGGGCATGGCGCACACGTCGACATCGTG
GCGGCCGACCTCGGCGACCGCACGAGCGTGGCCGCGCTCCTCGCCACGGTCGACGCCGAC
CACCCCCTGTCGGCCGTCGTGCACGCCGCCGGAGCGCTGGACGACGGCGTGCTCGGCACC
CGGTCCGCCGACTGGCTCGACCCGGTCCTGCGCCCCAAGGCGGACGCCGCTTGGCACCTG
CACGAACTCACCGCCGAACTGCCTCTGACCGCCTTCGTCATGTTCTCCTCGGCCGCATCC
GTGCTCGGCGCGGCGGGACAGGCCAACTACGCCGCGGCCAACGGATTTCTGGACGCACTG
GCCGCCCATCGTGCCGCCCGGGGACTGCCCGGGACCTCGCTGGCCTGGGGGCTGTGGGAG
CACCGCAGCGAACTGACCCGGCACACGGGCTCCCCCTCCCGCAGCATCGCGGCCGTCGGC
GCTCTGTCCACCGCGGAGGCCCTTGCCGCCTTCGACGCCGGCCTGGCCTCCGGGGAGCCG
CTGGCAGTGCCGATCCGGCTGGAGTCGACATCCAGTGAGGAGGTACCGCCGATGCTGCGC
GGCCTGGTCCGCGTACGCCGCCGGGCCGCCACCGGCACGGAACCCGCGGCGAGCGCGGGC
GCCGCGCAGGAGGTCCGGCAGCTGGCCGAGTTGGGCGCCGACGAGCGACAGCGGCGCGTG
CAGCGGATCGTGCTCGACACCGCGGCGGCCGTCCTCGGCCATGACAGCCACGACGCCATC
CCCCTCACCCGGGGCTTCCTGGAGCTGGGGTTCGACTCCCTGACAGCGGTACGGCTGCGC
AACCGGCTCGCCCGCCGACTGGGGCTGCGCCTGCCGGCCACGGTGGTGTTCGACCACCCC
AGCCCGGCCGCCCTGGCCGCCCACCTGGTCGAGCATCTCGTGGGCACCGTCGACCCGACC
GCGCAGGCCATGGAGCAGCTGGAGGCTCTGCGCCGCAGCGTGCACGCAGCCACACCCGCC
GGTGGCCTGGACCGCGCCCTGGTGACCCAACGCCTGACGGCCCTGCTCGACGAAATGCGG
CACGTCGACGGCCCCGGCGGCACCGAAGGCCCCGACGGCTCCGGGGACGACCTGGAGAAC
GCGACAGCGGACGAGATCTACGCCCTCATCGACAACGAACTGGGCATCGGGGGTACGCAG
TGA
[2] KS34..410
[2] AT560..866
[2] malonyl-CoA739..743
[2] DH913..1076
[2] KR1356..1529
[2] ACP1628..1698
[3] KS1724..2100
[3] AT2245..2555
[3] methylmalonyl-CoA2433..2437
[3] DH2603..2760
[3] KR3062..3242
[3] ACP3336..3410
[2] KS100..1230
[2] AT1678..2598
[2] malonyl-CoA2215..2229
[2] DH2737..3228
[2] KR4066..4587
[2] ACP4882..5094
[3] KS5170..6300
[3] AT6733..7665
[3] methylmalonyl-CoA7297..7311
[3] DH7807..8280
[3] KR9184..9726
[3] ACP10006..10230

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [550-677]  G3DSA:3.40.366.10 [739-857]  G3DSA:3.40.366.10 [2243-2365]  G3DSA:3.40.366.10 [2433-2546]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [3368-3383]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1631-1697]  5.29999999999999e-11 PF00550 [3344-3409]  1.4e-13 PF00550
PF00550   PP-binding
 [1621-1740]  4.90001027782405e-25 SSF47336 [3332-3427]  1.60000240695997e-22 SSF47336
SSF47336   ACP_like
 [1626-1701]  4.30000000000003e-41 G3DSA:1.10.1200.10 [3338-3414]  4.30000000000003e-41 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1628-1698]  PS50075 [3336-3410]  PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [1356-1528]  2.29999999999998e-56 PF08659 [3062-3240]  7.5e-59 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-283]  4.59999999999996e-98 PF00109 [1724-1974]  1.69999999999998e-92 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-410]  1.70000000000001e-48 PF02801 [1982-2100]  4.5e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [560-866]  5.49999999999995e-62 PF00698 [2245-2555]  1.29999999999998e-86 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  6.40000000000001e-09 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [557-849]  1.19999063421924e-74 SSF52151 [2243-2527]  5.20000089003336e-60 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [679-738]  1.09999909120787e-12 SSF55048 [2368-2432]  2.09999806691534e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [36-296]  G3DSA:3.40.47.10 [297-463]  G3DSA:3.40.47.10 [1726-1986]  G3DSA:3.40.47.10 [1987-2153]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-408]  6.80004680300024e-107 SSF53901 [1716-2098]  7.6999848053369e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1352-1545]  8.30000000000004e-62 G3DSA:3.40.50.720 [3062-3263]  3.29999999999997e-63 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606 [1887-1903]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [561-848]  1.09999184471405e-114 SM00827 [2247-2537]  8.99992502689852e-108 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1629-1701]  3.69999438558106e-28 SM00823 [3341-3413]  1.50000306971104e-31 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [913-1076]  2.39999798157263e-83 SM00826 [2603-2760]  5.89998809405682e-71 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-463]  SM00825 [1726-2153]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1356-1529]  4.10001399699315e-61 SM00822 [3062-3242]  6.79998707392899e-55 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit