close all open/close all

CDS information : Borre_00180


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction34,224 / 39,047 / + [in whole cluster]
34,224 / 39,047 / + [in contig]
Location34224..39047 [in whole cluster]
34224..39047 [in contig]
TypeCDS
Length4,824 bp (1,607 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)borrelidin polyketide synthase, type I
Gene
Gene (GenBank)borA4
EC number
Keyword
Note
Note (GenBank)
  • Module 4 (b-ketoacyl-ACP-synthase, acyltransferase, ketoreductase, acylcarrier protein)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
[14651102] Evidence from engineered gene fusions for the repeated use of a module in a modular polyketide synthase. (Chem Commun (Camb). , 2003)

close this sectionPKS/NRPS Module

4 methylmalonyl-CoA
KS21..397
AT542..852
KR1168..1346
ACP1446..1516

close this sectionSequence

selected fasta
>polyketide synthase [borrelidin polyketide synthase, type I]
MTADLRSARARLQELESADTDPIAIIGMGCRLPGGVRTPEDLWDLVEKKHDAIGPFPADR
GWDLENLYDPDPDAPGKAYVREGGFVHDVAGFDAGFFGISPREALAMDPQHRLLLECSWE
ALERAGIDPSSLEGTRTGVYTGLMTHEYATRLPSIDEELEGVIGIGNAGSVASGRVSYTL
GLNGPAVTVDTACSSSLVALHLAAQALRQGQCTLALAGGASVIAAPTVFATFSRQRGLAP
DGRCKAFSSTTDGTGFGEGVGVLVLERLSDARRNGHEVLAVVRGSAVNQDGASSGFTAPN
GPSQQDVIREALADGRLTPADVDVVEGHGTGTRLGDPIEAQALLATYGRGRDADRPLWLG
SVKSNIGHTQAAAGVASVIKMVQAMQAGVLPRTLHVDEPSGEVDWDSGAVRLLTEAREWP
SGEGRVRRAGVSSFGISGTNAHVILEEPPAEDALPEPEAGDVVPWVLSARSAEALREQAA
RLASVAGGLNVVDVGWSLASTRAAFEHRAVVVGGDREELLGKLSSVSGVEVGVGVGAGGG
VVLVFAGQGCQWVGMGRELLGSSLVFAESMRECAAALSPFVDFSVVDVLGSAGELGRVEV
VQPALWAVMVSLARVWRSWGVPVAAVVGHSQGEIAAATVAGALSVGDAARVVALRSRLIA
ERLSGLGGMVSVALSRERVVSLIAGVPGVSVAAVNGSSSTVVSGEAAGLERVLAACVSSG
VRARRIDVDYASHSVQVELIREELLGVLDGIVPRSGEIPFVSTVTGERIDTVELGAEYWY
RNLRQTVEFQSVVEGLVAQGCRVFLESSPHPVLTVGIEESADRVVALESLRRGEGGLRRL
VDAAGEAWVRGVPIDWAGMLAGGRRVDLPTYPFQHQPYWLDSPRHPAGDVTGPGDDEFWA
AVEHGEATELADLLRRSAAEPGQDLHAPVAALLPTLATWRRDRQRRAAVDSWRYRIVWRP
VATPSYDRVLSGRWAVVVPAGHEDDPVVDWVCSALRDHGGEPERMVLGPRESRSALATRL
AADPPGGVVSLLGLSGAAHPDHEVLPSAVAGTVLLAQALSDGAVRAPVWTLTRNGVSATA
TDPVAPTHAAQVWAVARVAGLEHPEAWGGLLDLPDRLDDRAAARFAAVLSAGEDEDQLAL
RDAGLLARRLVRAPVPRDAVTAGWQPRDTALVTGGTGGLGGQVARWLAAAGVRHLVLVSR
RGAEAEGADRLRDDLTALGVQVTFGACDVADRAALSALLDRVQEDGPPIRTVVHAAGSGR
AARLLDTDAEETAAVLRAKSAGARNLHELLDDVDAFVLFSSGAGVWGSSAQGAYAAANAY
LDALAEQRRGQGRPATSVAWGAWAGDGMTAAAGEEWWSRQGLRFMAPEAALDALRQAVDR
AESTLVVADIDWKTFAPLFTSARSRPLITDIPEARPEPRPEGADQPTQGLVAKLAVLSAD
ERRRALLAEVRAQAAVVLGHPGADAVPVDRPFRELGFDSLSAVKLRNRIVAATGLELPAT
LVFDHPTSTALAAYLGARLGIDGAPAGSTLLEDLARLESTVATLTAAPLAETVPDARDRA
ALTTRLRALLERWDQADGEDQAAAREELDDLSDDDLFDFIDAKFGRS
selected fasta
>polyketide synthase [borrelidin polyketide synthase, type I]
GTGACCGCGGACCTGCGGTCGGCGAGAGCCAGGCTGCAGGAACTGGAGTCCGCCGACACC
GACCCCATCGCCATCATCGGCATGGGCTGCCGTCTGCCCGGTGGCGTGCGCACCCCCGAG
GACCTGTGGGACCTCGTGGAGAAGAAGCATGACGCGATCGGCCCCTTCCCCGCCGACCGC
GGATGGGACCTCGAGAACCTGTACGACCCCGACCCGGACGCGCCGGGCAAGGCCTACGTC
CGCGAAGGTGGGTTCGTCCACGACGTCGCCGGCTTCGACGCGGGCTTCTTCGGAATCTCG
CCGCGTGAGGCGCTGGCGATGGACCCGCAACACCGGCTTCTGCTGGAGTGCTCGTGGGAG
GCCCTGGAGCGGGCGGGCATCGACCCTTCCTCCCTCGAGGGCACCCGCACCGGCGTCTAC
ACCGGGCTCATGACCCATGAATACGCGACCCGACTGCCCTCGATCGACGAGGAGTTGGAG
GGTGTCATCGGCATCGGCAACGCCGGAAGCGTTGCCTCGGGCCGCGTCTCCTACACGCTC
GGCCTGAACGGCCCCGCTGTCACCGTCGACACGGCCTGCTCCTCCTCGCTCGTCGCCCTG
CACCTCGCCGCCCAAGCCCTGCGCCAGGGCCAGTGCACCCTTGCGCTGGCCGGAGGTGCC
TCCGTCATCGCGGCGCCGACCGTGTTCGCCACCTTCAGCCGACAGCGGGGCCTCGCCCCC
GACGGCCGCTGCAAGGCGTTCTCGTCCACGACCGACGGCACGGGCTTCGGCGAGGGGGTG
GGCGTACTGGTCCTGGAGCGCCTCTCGGACGCCCGTCGCAACGGACACGAGGTCCTGGCC
GTCGTACGGGGCTCGGCGGTCAACCAGGACGGAGCCAGCAGCGGATTCACCGCCCCGAAC
GGACCGTCCCAGCAGGACGTCATCCGCGAGGCCTTGGCCGACGGTCGACTGACCCCTGCG
GACGTGGACGTCGTGGAGGGTCACGGTACGGGGACGCGGTTGGGTGATCCGATCGAGGCG
CAGGCGTTGCTGGCGACGTACGGGCGGGGGCGTGACGCGGATCGTCCGTTGTGGCTGGGG
TCGGTGAAGTCGAACATCGGTCACACGCAGGCGGCCGCGGGTGTGGCAAGCGTGATCAAG
ATGGTGCAGGCGATGCAGGCGGGCGTGCTGCCGCGGACGCTGCATGTGGACGAGCCGTCG
GGTGAGGTGGATTGGGACTCGGGTGCGGTGCGGCTGCTGACCGAGGCGCGCGAGTGGCCG
TCGGGGGAGGGGCGTGTGCGGCGGGCGGGTGTGTCGTCGTTCGGGATCTCCGGGACGAAC
GCGCACGTGATCCTTGAGGAGCCGCCGGCGGAGGACGCGCTGCCGGAGCCTGAAGCGGGT
GATGTGGTGCCGTGGGTTCTTTCGGCGCGGTCGGCAGAGGCGTTGCGGGAGCAGGCTGCC
CGGCTGGCGTCGGTGGCTGGTGGGTTGAACGTGGTGGATGTGGGCTGGTCGTTGGCTTCG
ACGCGTGCGGCGTTCGAGCACCGGGCCGTCGTCGTGGGAGGCGATCGGGAAGAGCTCCTG
GGGAAGCTTTCCTCGGTTTCGGGGGTCGAGGTCGGGGTCGGGGTCGGTGCCGGTGGTGGT
GTGGTGTTGGTGTTCGCCGGTCAGGGGTGTCAGTGGGTCGGTATGGGGCGGGAGTTGCTG
GGTTCCTCGCTGGTGTTCGCGGAGTCGATGCGGGAGTGCGCGGCGGCTCTGTCGCCGTTT
GTGGACTTTTCTGTGGTGGATGTTCTGGGTTCGGCTGGGGAGTTGGGTCGGGTCGAGGTG
GTTCAGCCTGCGTTGTGGGCGGTGATGGTGTCGCTGGCGCGGGTGTGGCGGTCGTGGGGT
GTTCCGGTTGCTGCGGTGGTGGGTCATTCGCAGGGTGAGATTGCCGCGGCGACGGTGGCG
GGTGCGTTGAGTGTGGGTGATGCGGCGCGGGTGGTGGCGTTGCGGAGCCGTTTGATCGCG
GAGCGTCTGTCGGGGCTGGGTGGGATGGTTTCGGTGGCGTTGTCGCGTGAGCGGGTGGTG
TCGTTGATCGCGGGTGTGCCGGGTGTGTCGGTGGCGGCGGTGAACGGTTCTTCGTCGACG
GTGGTCTCGGGTGAGGCCGCGGGGCTGGAGAGGGTGCTGGCCGCGTGTGTGTCGTCGGGG
GTTCGGGCGCGTCGTATCGATGTGGATTACGCCTCGCATTCGGTGCAGGTGGAGTTGATC
CGTGAGGAGTTGTTGGGGGTTCTGGACGGGATCGTCCCGCGCTCGGGTGAGATTCCGTTC
GTGTCCACGGTGACGGGTGAGCGGATCGACACTGTCGAGCTGGGGGCGGAGTACTGGTAC
CGCAATCTCCGTCAGACAGTGGAATTCCAGTCGGTGGTGGAGGGTCTGGTCGCTCAGGGG
TGTCGGGTGTTCCTGGAGTCCAGTCCGCATCCGGTGTTGACGGTCGGCATCGAGGAGTCC
GCGGATCGGGTCGTGGCGTTGGAGTCGCTGCGTCGTGGCGAGGGTGGTCTGCGGCGGTTG
GTGGATGCGGCCGGTGAGGCGTGGGTGCGTGGGGTGCCGATCGACTGGGCGGGGATGCTC
GCCGGCGGCCGGCGGGTCGACCTGCCCACCTATCCCTTCCAACACCAGCCCTACTGGCTC
GACTCACCACGACACCCTGCCGGAGACGTGACCGGCCCGGGCGACGACGAGTTCTGGGCG
GCCGTGGAGCACGGTGAGGCGACCGAGTTGGCGGACCTGCTCCGGAGGTCGGCGGCGGAG
CCGGGGCAGGATCTTCACGCACCCGTCGCGGCCCTGCTGCCGACGCTTGCAACGTGGCGT
CGGGACCGGCAGCGCAGGGCGGCTGTGGACTCCTGGCGGTACCGGATCGTATGGCGTCCG
GTCGCCACGCCCTCGTACGACAGGGTGCTGTCGGGGCGCTGGGCTGTCGTCGTGCCCGCC
GGTCACGAGGACGACCCCGTCGTCGACTGGGTCTGCTCGGCGCTGCGGGACCACGGGGGC
GAGCCCGAACGCATGGTGCTGGGCCCGCGGGAGAGCCGTTCGGCGCTGGCCACGCGGCTG
GCCGCCGATCCCCCCGGGGGCGTGGTCTCCCTGCTCGGACTGAGCGGGGCGGCGCACCCC
GACCACGAGGTGCTGCCCAGTGCCGTCGCCGGTACCGTCCTGCTTGCCCAGGCCCTCTCC
GACGGCGCCGTACGAGCACCGGTGTGGACCCTGACCCGCAACGGTGTGTCCGCGACGGCG
ACGGACCCGGTGGCTCCCACGCACGCCGCGCAGGTGTGGGCCGTGGCACGGGTGGCCGGT
CTGGAGCACCCGGAGGCGTGGGGTGGTCTGCTCGACCTGCCGGACCGTCTCGACGACCGC
GCGGCCGCCCGGTTCGCCGCGGTCCTGTCCGCGGGCGAGGACGAGGACCAACTGGCATTA
CGCGACGCTGGGTTGCTGGCACGAAGGCTGGTGCGTGCCCCCGTTCCGCGCGACGCGGTG
ACCGCCGGCTGGCAGCCCCGCGACACAGCGCTCGTCACGGGCGGCACCGGCGGTCTCGGC
GGGCAGGTCGCCCGCTGGCTGGCGGCCGCGGGCGTACGGCACCTCGTGCTGGTCAGCCGT
CGGGGGGCGGAGGCGGAGGGCGCAGACCGTCTGCGCGACGACCTCACCGCCCTCGGCGTA
CAGGTGACGTTCGGCGCGTGCGACGTCGCGGACCGCGCCGCGCTCTCGGCGCTCCTCGAC
CGGGTTCAGGAGGACGGCCCGCCGATCCGCACGGTCGTGCACGCGGCGGGCTCCGGTCGC
GCCGCCAGGCTGCTGGACACCGACGCCGAGGAGACCGCGGCGGTGCTGCGGGCGAAGTCG
GCCGGAGCCCGGAACCTGCACGAACTCCTCGATGACGTGGACGCGTTCGTGCTGTTCTCC
TCCGGAGCGGGTGTGTGGGGAAGCAGCGCCCAGGGCGCCTACGCGGCGGCCAACGCCTAC
CTGGACGCACTGGCCGAACAGCGCAGGGGCCAGGGGCGGCCGGCGACCTCCGTCGCCTGG
GGCGCCTGGGCCGGTGACGGCATGACAGCCGCCGCCGGCGAGGAATGGTGGAGCAGGCAG
GGTCTGCGGTTCATGGCCCCTGAGGCCGCCCTCGACGCGCTGCGCCAGGCCGTCGACCGC
GCCGAGAGCACGCTCGTCGTCGCAGACATCGACTGGAAGACGTTCGCTCCCCTCTTCACG
TCGGCCCGCAGCCGCCCCCTCATCACCGACATACCTGAAGCCCGCCCCGAACCGAGGCCG
GAAGGCGCGGACCAGCCTACGCAGGGCCTCGTGGCCAAGCTGGCGGTGCTGTCCGCGGAC
GAACGGCGGCGCGCCCTGCTCGCCGAGGTGCGGGCGCAGGCAGCGGTGGTGCTCGGCCAC
CCCGGCGCGGACGCCGTACCGGTCGACCGGCCGTTCCGCGAGCTCGGATTCGACTCCCTC
AGCGCGGTGAAACTGCGCAACAGGATCGTTGCTGCCACCGGGCTCGAGCTTCCGGCCACC
CTGGTCTTCGACCACCCCACGTCCACGGCGCTCGCCGCCTACCTGGGCGCCCGGCTCGGA
ATCGACGGCGCCCCCGCGGGGTCCACTCTGCTGGAAGACCTCGCGCGGCTCGAGTCCACC
GTCGCCACCCTGACCGCGGCACCTCTCGCAGAGACCGTGCCGGACGCCCGGGACCGCGCG
GCGCTCACCACACGGCTGCGGGCGTTGCTGGAGCGGTGGGACCAGGCCGATGGCGAGGAC
CAGGCCGCCGCCCGAGAAGAACTCGACGATCTGAGCGACGACGACCTCTTCGACTTCATC
GACGCGAAGTTCGGCCGTTCGTGA
[4] KS21..397
[4] AT542..852
[4] methylmalonyl-CoA730..734
[4] KR1168..1346
[4] ACP1446..1516
[4] KS61..1191
[4] AT1624..2556
[4] methylmalonyl-CoA2188..2202
[4] KR3502..4038
[4] ACP4336..4548

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [540-662]  5.50000000000008e-68 G3DSA:3.40.366.10 [730-843]  5.50000000000008e-68 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1474-1489]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1446-1516]  PS50075
PS50075   ACP_DOMAIN
 [1438-1533]  3.69999438558106e-21 SSF47336
SSF47336   ACP_like
 [1443-1519]  5.20000000000001e-22 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1449-1515]  3.7e-11 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [1169-1345]  2.59999999999998e-61 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [21-271]  1.5e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [279-397]  2.1e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [542-852]  4.2e-87 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [540-824]  5.20000089003336e-60 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [665-729]  2.09999806691534e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [23-283]  1.60000000000002e-91 G3DSA:3.40.47.10 [284-450]  5.90000000000008e-65 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [13-395]  6.29998179434741e-107 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1168-1377]  8.00000000000001e-39 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [184-200]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [544-834]  8.99992502689852e-108 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1447-1519]  2.39999798157265e-34 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [23-450]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1168-1346]  1.3000049540733e-50 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit