close all open/close all

CDS information : Borre_00190


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction39,044 / 45,514 / + [in whole cluster]
39,044 / 45,514 / + [in contig]
Location39044..45514 [in whole cluster]
39044..45514 [in contig]
TypeCDS
Length6,471 bp (2,156 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)borrelidin polyketide synthase, type I
Gene
Gene (GenBank)borA5
EC number
Keyword
  • iterative
Note
Note (GenBank)
  • Module 5 (b-ketoacyl-ACP-synthase, acyltransferase, dehydratase, enoylreductase, ketoreductase, acylcarrier protein)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
[14651102] Evidence from engineered gene fusions for the repeated use of a module in a modular polyketide synthase. (Chem Commun (Camb). , 2003)

close this sectionPKS/NRPS Module

5 methylmalonyl-CoA
KS60..434
AT579..894
DH941..1098
ER1409..1714
KR1724..1900
ACP2001..2071

close this sectionSequence

selected fasta
>polyketide synthase [borrelidin polyketide synthase, type I]
MTSVGRRQLHVHPEDHDHHAKRTGLSMGDEQKLRTYLRRVTADLADVTERLQRAEDKNAE
PIAIVGMGCRYPGGVRSPEEFWNLLDEGVDAVAGFPEDRGWDLENLYDPDPDEPGKCYAR
EGGFLYDAGEFDAAFFGISPREALSMDPQQRLLLECSWSALERAGIDPGSLRGKDVGVYV
GAWNSNYGRGGGAESSEGHLLTGNASSVVSGRVAYVLGLEGPAVTIDTACSSSLVGLHLA
AQALRSGECGLALAGGVTVMSTPLSLVSFSRQRGLAQDGRSKAFSADADGMGMAEGVGVL
VLERLSEARRNGHEVLAVLRSSAVNQDGASNGLSAPNGPAQQRVIQSALTVGRLAPSDID
VVEAHGTGTALGDPIEAQALLATYGRGRDADRPLWLGSVKSNIGHTQAAAGVAGVIKMVL
ALRKGVLPRTLHVDEPTGEVDWDSGAVRLLTEAREWPSGEGRVRRAGVSSFGISGTNAHV
IVEEAPEEEPRPEAPSVDVVPWVLSARSAEALREQAARLASVAGGLNVVDVGWSLASTRA
AFEHRAVVVGRDSEELVSGLSSVSGVEVGVGVGAGGGVVLVFAGQGCQWVGMGRELLGSS
LVFAESMRECAAALSPFVDFSVVDVLGSAGELGRVEVVQPALWAVMVSLARVWRSWGVPV
AAVVGHSQGEIAAATVAGALSVGDAARVVALRSRLIAERLSGLGGMVSVALSRERVVSLI
AGVPGVSVAAVNGSSSTVVSGEAAGLERVLAACVSSGVRARRIDVDYASHSVQVELIREE
LLGVLDGIVPRSGEIPFVSTVTGERIDTVELGAEYWYRNLRQTVEFQASVQTLLAQGHQV
FLESSPHPVLTVGIEETVHESAAQAVVLGSLRRDEGALTRLVTSAGEAWARGVPVDWAGM
LAGGRRVELPTYPFLRERLWLEPSRSRTGNLNMAGLVEAGHEILPAAVELPGEQWVWTGE
LSLSAYPWLADHQVLGQTLVPGVAWVELALHAGHQLGFGSVEELTLQAPLVLGESDAVQV
RVVVSDLGESDRRAVSVHSRGDDQTWVTHAEGFLTAKGAQPETMAVWPPSGAEPVEADGF
YERLADAGYHYGPVFQGVSKVWRAGEEIYAEVGLLDDADVDGFGIHPALLDAALQTAYVA
QRGPAETKLPFAFGDVQLFATGARSLRVRVSPAAQQGMAWEAWDPTGLPVFSLGYLATRP
VDRGQLTVKRPESLFKVAWDETVPVVGNATAAHGVVLGDDPFALGAALRAAGWEVGAAPE
PASADTAAEVLLLPCTAPGEPDADLPTAVRAVTARVLGVLQEWLADERLAGTRLAVVTRN
ALPGDLLHSPVWGLVRSAQTENPGRITLVDLDDHPDSAAVLAEAVQSDEPRIMVREGRPT
AARLVRATAPELVPPAGADAWRLEITEPGTFDNLTLGVYPHAEKTLADNEVRVAVHAGGL
NFHDVVAALGMVEDDLTLGREAAGVVVEVGDAVPDLTPGDHVMGILSSGFGPLAVTDHRY
LARMPEGWTFAQAASVPAAFLTAYYGLCDLGGIRAGDRVLIHAAAGGVGMAAVQIARHLG
AEVFGTASPRKWGALRALGLDDAHLSSSRTLDFEQEFLDATDGRGVDLVLNSLAREFVDA
SLRLMPGGGRFVDMGKTDIRRPEQVAEDHGGVAYQAFDLVEAGPQRTGEMLAEIVRLFQA
GAFRPLPITQWDVRRAPEAFRHISQAKHIGKIVLTVPRPIDTDGTVMVTGATGTLGGFVA
RHLVTHHGIRRLLLVSRSAERTDLVRELTELGADVTWASCDLADATAVEETVRSVDERHP
LVAVVHSAGVLDDGVIDKQSPERLDTVMRPKVDAAWNLHRLLDNAPLADFVLFSSASGVL
GGAGQSNYAAANAFLDALAEHRRAQGLAGQALAWGLWSDRSTMTGQLGSTELARIARNGV
AEMSETEGLALFDAARDTAEAVLLPMHLDVARLRSRNGEVPAVFRRLIHATARRTASTAV
RSAGLEQQLASLSGPERTELLLGLVRDHAAAVLGHGTSDAVSPDRPFRDLGFDSLTAVEL
RNRFAALTGLRLPATLVFDHPSPTALAGHLAGLLGAATPSAAEPVLAAVGRLRADLRSLT
PDAEGAEDVTIQLEALLAEWREAAEKRAPEAVGDEDLSTATDDEIFALVDSELGEA
selected fasta
>polyketide synthase [borrelidin polyketide synthase, type I]
GTGACCTCGGTCGGCCGCCGCCAACTCCACGTACACCCCGAAGACCACGATCACCACGCG
AAAAGGACGGGCCTCTCCATGGGGGACGAGCAGAAACTCCGCACCTACCTCCGGCGCGTC
ACTGCCGACCTGGCCGACGTGACGGAGCGGTTGCAGCGAGCAGAGGACAAGAACGCCGAG
CCGATCGCGATCGTCGGCATGGGGTGCCGCTACCCCGGTGGGGTGCGGTCGCCCGAGGAG
TTCTGGAACCTGCTCGACGAAGGCGTCGACGCAGTGGCCGGCTTCCCCGAGGACCGTGGC
TGGGACCTGGAGAACCTGTACGACCCCGACCCCGACGAGCCGGGTAAGTGCTATGCCCGC
GAAGGCGGGTTCCTCTACGACGCGGGCGAGTTCGACGCCGCGTTCTTCGGGATATCGCCC
CGCGAGGCCCTGTCCATGGACCCGCAGCAGCGGCTGCTGCTGGAGTGCTCCTGGAGTGCC
CTCGAGCGGGCGGGCATCGACCCGGGCTCGCTGCGCGGCAAAGACGTCGGCGTGTACGTC
GGCGCATGGAACAGCAACTACGGCAGGGGCGGCGGGGCGGAGAGCTCCGAGGGCCACCTG
CTGACCGGCAACGCCTCCAGCGTGGTCTCGGGTCGCGTGGCGTACGTGCTGGGGCTCGAA
GGCCCCGCCGTCACCATCGACACCGCCTGTTCCTCCTCCCTGGTCGGCCTGCACCTGGCC
GCCCAGGCCCTCAGGTCCGGCGAGTGCGGTCTTGCGCTGGCCGGCGGCGTCACCGTGATG
TCCACCCCTCTGTCGCTGGTGTCCTTCTCCCGGCAGCGGGGGCTCGCACAGGACGGTCGT
TCCAAGGCGTTCTCGGCGGACGCCGATGGCATGGGCATGGCCGAAGGTGTAGGCGTACTG
GTCCTGGAGCGCCTCTCGGAGGCGCGCCGCAACGGGCACGAGGTCCTGGCCGTCCTGCGG
AGCTCGGCCGTGAACCAGGATGGTGCCTCGAACGGTCTGAGCGCCCCGAACGGGCCGGCG
CAGCAGCGTGTCATCCAGTCCGCCCTGACCGTCGGCCGTCTCGCCCCCTCCGACATCGAC
GTCGTCGAGGCCCACGGCACCGGCACGGCCCTCGGCGATCCGATCGAGGCGCAGGCGTTG
CTGGCGACGTACGGGCGGGGGCGTGATGCGGATCGTCCGTTGTGGCTGGGGTCGGTGAAG
TCGAACATCGGTCACACGCAGGCGGCCGCGGGTGTGGCCGGGGTCATCAAGATGGTGCTG
GCCCTGCGCAAGGGCGTACTGCCGCGGACGTTGCATGTGGATGAGCCAACCGGTGAGGTG
GATTGGGACTCGGGTGCGGTGCGGCTGCTGACCGAGGCGCGCGAGTGGCCGTCGGGGGAG
GGGCGTGTGCGGCGGGCGGGTGTGTCGTCGTTCGGGATCTCCGGGACGAACGCGCATGTG
ATCGTCGAGGAGGCTCCGGAGGAGGAGCCCCGGCCGGAGGCTCCTTCCGTCGACGTGGTG
CCGTGGGTTCTTTCGGCGCGGTCGGCAGAGGCGTTGCGGGAGCAGGCTGCCCGGCTGGCG
TCGGTGGCTGGTGGGTTGAACGTGGTGGATGTGGGCTGGTCGTTGGCTTCGACGCGTGCG
GCGTTCGAGCACCGGGCCGTGGTGGTGGGGCGGGACTCCGAGGAATTGGTGTCGGGGCTT
TCCTCGGTTTCGGGGGTCGAGGTCGGGGTCGGGGTCGGTGCCGGTGGTGGTGTGGTGTTG
GTGTTCGCCGGTCAGGGGTGTCAGTGGGTCGGTATGGGGCGGGAGTTGCTGGGTTCCTCG
CTGGTGTTCGCGGAGTCGATGCGGGAGTGTGCGGCGGCTCTGTCGCCGTTTGTGGACTTT
TCTGTGGTGGATGTTCTGGGTTCGGCTGGGGAGTTGGGTCGGGTCGAGGTGGTTCAGCCT
GCGTTGTGGGCGGTGATGGTGTCGCTGGCGCGGGTGTGGCGGTCGTGGGGTGTTCCGGTT
GCTGCGGTGGTGGGTCATTCGCAGGGTGAGATTGCCGCGGCGACGGTGGCGGGTGCGTTG
AGTGTGGGTGATGCGGCGCGGGTGGTGGCGTTGCGGAGCCGTTTGATCGCGGAGCGTCTG
TCGGGGCTGGGTGGGATGGTTTCGGTGGCGTTGTCGCGTGAGCGGGTGGTGTCGTTGATC
GCGGGTGTGCCGGGTGTGTCGGTGGCGGCGGTGAACGGTTCTTCGTCGACGGTGGTCTCG
GGTGAGGCCGCGGGGCTGGAGAGGGTGCTGGCCGCGTGTGTGTCGTCGGGGGTTCGGGCG
CGTCGTATCGATGTGGATTACGCCTCGCATTCGGTGCAGGTGGAGTTGATCCGTGAGGAG
TTGTTGGGGGTTCTGGACGGGATCGTCCCGCGCTCGGGTGAGATTCCGTTCGTGTCCACG
GTGACGGGTGAGCGGATCGACACTGTCGAGCTGGGGGCGGAGTACTGGTACCGCAATCTC
CGTCAGACAGTGGAATTCCAAGCATCCGTGCAGACGCTCCTCGCCCAGGGGCACCAGGTC
TTCCTGGAGTCCAGTCCGCACCCGGTTCTCACCGTCGGCATCGAGGAGACCGTTCACGAG
AGCGCCGCACAGGCCGTCGTTCTGGGAAGCCTGCGGCGGGACGAGGGTGCCCTCACCCGG
CTCGTCACCTCCGCCGGTGAGGCATGGGCGCGCGGTGTGCCCGTCGACTGGGCGGGCATG
CTCGCCGGCGGCAGGCGGGTCGAGTTGCCCACGTATCCCTTCCTCCGGGAGCGGCTGTGG
CTGGAGCCGTCGCGCTCCCGCACCGGGAACCTCAACATGGCCGGGCTGGTCGAAGCCGGA
CATGAAATCCTGCCCGCCGCAGTGGAGTTGCCCGGAGAGCAGTGGGTGTGGACCGGCGAG
CTGTCGCTCTCCGCGTACCCGTGGCTGGCCGATCACCAGGTGCTCGGGCAGACCCTGGTG
CCGGGCGTGGCGTGGGTCGAACTCGCCCTGCACGCGGGCCACCAGCTCGGTTTCGGATCC
GTCGAGGAACTCACCCTGCAGGCACCGCTCGTGCTCGGCGAGTCCGACGCCGTGCAGGTC
AGAGTCGTTGTCTCCGATCTCGGGGAGAGTGATCGCCGGGCAGTGTCGGTGCACTCGCGT
GGTGACGACCAGACGTGGGTGACCCATGCGGAGGGATTCCTCACCGCGAAAGGGGCGCAG
CCGGAGACCATGGCCGTGTGGCCGCCGTCCGGTGCGGAGCCGGTGGAGGCTGACGGGTTC
TACGAACGCCTCGCCGATGCGGGGTACCACTATGGCCCGGTCTTCCAGGGCGTGAGCAAG
GTCTGGCGAGCTGGCGAGGAGATCTACGCCGAGGTCGGGCTGCTCGACGACGCCGACGTG
GACGGCTTCGGCATCCACCCCGCCCTGCTCGACGCCGCCCTGCAGACCGCCTACGTCGCC
CAACGGGGCCCCGCAGAGACGAAGTTGCCTTTCGCGTTCGGCGATGTACAGCTGTTCGCC
ACCGGTGCCCGGTCGCTCCGCGTACGGGTCTCGCCGGCCGCTCAGCAGGGGATGGCGTGG
GAGGCCTGGGACCCCACCGGACTTCCGGTGTTCTCCCTCGGGTACCTGGCGACCCGGCCG
GTCGACCGCGGCCAGCTGACCGTGAAGCGGCCCGAGTCGCTGTTCAAGGTGGCCTGGGAC
GAGACCGTCCCCGTCGTCGGGAATGCGACCGCCGCGCATGGCGTCGTGCTGGGCGACGAC
CCGTTCGCCCTCGGTGCCGCGCTGCGCGCGGCGGGCTGGGAGGTCGGGGCCGCCCCGGAA
CCCGCGTCCGCCGACACCGCCGCCGAAGTACTGCTGCTGCCCTGCACCGCGCCCGGCGAG
CCGGACGCGGACCTGCCCACCGCGGTCAGGGCCGTGACTGCTCGGGTGCTCGGCGTCCTA
CAGGAGTGGCTCGCCGACGAACGGCTCGCCGGCACCCGACTGGCCGTCGTGACCCGCAAC
GCCCTGCCGGGTGACCTCCTGCACAGCCCCGTCTGGGGTCTCGTGCGCTCCGCCCAGACC
GAGAACCCCGGGCGCATCACCCTCGTCGACCTCGACGACCACCCCGACTCGGCGGCCGTC
CTTGCCGAGGCCGTCCAGTCCGACGAGCCGCGCATCATGGTCCGCGAGGGCCGGCCCACC
GCCGCCCGCCTGGTCCGTGCCACCGCACCCGAGCTGGTGCCGCCCGCCGGAGCCGATGCC
TGGCGCCTCGAGATCACCGAACCGGGCACGTTCGACAACCTCACGCTGGGCGTCTACCCG
CACGCCGAGAAGACCCTCGCCGACAACGAGGTCCGGGTCGCCGTCCACGCGGGCGGCCTC
AACTTCCACGACGTGGTCGCCGCACTCGGCATGGTCGAGGACGACCTGACCCTCGGCCGT
GAGGCGGCCGGCGTCGTCGTCGAGGTCGGAGACGCCGTGCCGGATCTGACCCCCGGCGAC
CACGTGATGGGCATCCTGTCCTCCGGCTTCGGGCCGCTCGCCGTCACCGATCACCGCTAC
CTGGCACGCATGCCCGAGGGCTGGACGTTCGCCCAGGCGGCTTCGGTGCCCGCCGCGTTC
CTGACGGCCTACTACGGGCTGTGCGACCTCGGCGGCATCCGCGCGGGCGACCGCGTCCTC
ATCCACGCGGCCGCCGGCGGTGTCGGCATGGCCGCCGTACAGATCGCCCGGCACCTCGGG
GCGGAGGTGTTCGGCACCGCCAGCCCGCGCAAGTGGGGCGCGCTGCGCGCCCTGGGGCTC
GACGACGCCCACCTGTCCTCCTCCCGCACCCTCGACTTCGAGCAGGAGTTCCTGGACGCC
ACCGACGGCAGGGGAGTCGACCTCGTTCTGAACTCGCTGGCCCGGGAGTTCGTCGACGCC
TCGCTGCGGCTGATGCCCGGCGGCGGCCGGTTCGTGGACATGGGCAAGACCGACATCCGG
CGGCCGGAACAGGTGGCGGAGGACCACGGCGGAGTCGCCTACCAGGCATTCGACCTCGTC
GAGGCCGGGCCGCAGCGCACGGGGGAGATGCTCGCCGAGATCGTCCGGCTCTTCCAAGCC
GGCGCGTTCCGGCCGCTGCCGATCACCCAGTGGGACGTGCGCCGGGCGCCGGAGGCCTTC
CGACACATCAGCCAGGCCAAGCACATAGGCAAGATCGTCCTCACCGTGCCCCGGCCCATC
GACACCGACGGCACCGTCATGGTCACCGGCGCCACCGGGACCCTGGGCGGCTTCGTCGCC
CGGCACCTGGTCACCCATCACGGCATACGACGACTGCTGCTGGTCAGCCGCAGCGCGGAG
CGCACCGACCTGGTGCGGGAACTCACCGAGCTGGGCGCCGACGTCACCTGGGCCTCCTGC
GACCTAGCCGACGCCACCGCCGTCGAAGAGACCGTTCGGTCCGTCGACGAACGGCATCCG
CTCGTGGCCGTCGTCCACTCTGCGGGAGTACTCGACGACGGCGTCATCGACAAGCAGAGC
CCCGAACGGCTCGACACCGTGATGCGTCCCAAGGTCGACGCCGCCTGGAATCTGCACCGA
CTCCTCGACAACGCCCCGCTGGCCGACTTCGTGCTCTTCTCCTCCGCCAGCGGCGTGCTC
GGTGGCGCCGGACAGTCCAACTACGCGGCCGCCAACGCCTTCCTCGACGCGCTCGCCGAG
CACCGCCGTGCACAGGGCCTCGCCGGACAGGCGCTCGCCTGGGGACTGTGGTCCGACCGC
AGCACGATGACGGGACAGCTCGGCTCCACCGAACTCGCCCGGATCGCCCGCAACGGCGTC
GCCGAGATGTCCGAGACGGAGGGCCTGGCCCTCTTCGACGCCGCCCGGGACACCGCCGAG
GCGGTGTTGCTGCCCATGCACCTGGACGTCGCGAGGCTCCGCAGCCGCAACGGAGAGGTA
CCCGCGGTGTTCCGCCGGCTGATCCACGCCACGGCCCGCCGCACCGCGAGCACCGCGGTC
CGCAGCGCCGGCCTCGAACAGCAGCTCGCCTCGCTGTCCGGCCCCGAACGCACGGAGCTG
CTCCTGGGACTGGTGCGCGACCATGCCGCCGCGGTGCTCGGCCACGGCACCTCCGACGCC
GTCTCGCCGGACCGGCCCTTCCGCGACCTGGGTTTCGACTCCCTGACTGCCGTGGAGCTG
CGTAACAGGTTCGCCGCCCTCACCGGCCTGCGTCTGCCGGCCACGCTCGTCTTCGACCAC
CCGAGCCCGACGGCCCTCGCCGGGCACCTCGCCGGCCTGCTGGGCGCCGCGACGCCCTCC
GCGGCCGAGCCGGTCCTGGCCGCCGTCGGACGGCTGCGCGCCGACCTCCGGTCGCTCACC
CCGGACGCCGAGGGCGCCGAGGACGTGACGATCCAGCTGGAGGCCCTCCTCGCCGAGTGG
CGGGAGGCCGCGGAGAAGCGGGCTCCGGAGGCGGTCGGTGACGAGGACCTGTCCACCGCC
ACCGACGACGAGATCTTCGCGCTCGTCGACAGCGAACTGGGTGAGGCCTGA
[5] KS60..434
[5] AT579..894
[5] methylmalonyl-CoA767..771
[5] DH941..1098
[5] ER1409..1714
[5] KR1724..1900
[5] ACP2001..2071
[5] KS178..1302
[5] AT1735..2682
[5] methylmalonyl-CoA2299..2313
[5] DH2821..3294
[5] ER4225..5142
[5] KR5170..5700
[5] ACP6001..6213

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [577-699]  6.40000000000004e-70 G3DSA:3.40.366.10 [767-883]  6.40000000000004e-70 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [1536-1557]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [2029-2044]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1993-2088]  1.29999924468179e-24 SSF47336
SSF47336   ACP_like
 [2005-2070]  1.3e-11 PF00550
PF00550   PP-binding
 [2001-2075]  3.09999999999998e-22 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [2001-2071]  PS50075
PS50075   ACP_DOMAIN
IPR011032 GroES-like (Domain)
 [1400-1543]  5.39999384454126e-30 SSF50129
SSF50129   GroES_like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1428-1484]  1e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1724-1899]  3.7e-60 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [60-308]  2.50000000000001e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [316-434]  1e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [579-894]  1.5e-91 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [27-52]  3.3e-08 PF08990
PF08990   Docking
 [30-60]  2.19999900980708e-06 SSF101173
SSF101173   Polyketide_synth_docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [577-866]  4.30000170645869e-61 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [702-766]  2.09999806691534e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [62-320]  7.30000000000007e-90 G3DSA:3.40.47.10 [322-489]  7.79999999999999e-64 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [52-432]  1.09999184471405e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1499-1688]  6.59999999999996e-54 G3DSA:3.40.50.720 [1724-1902]  7.5e-35 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [221-237]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [581-875]  2.2999842048857e-112 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [2002-2074]  2.39999798157265e-37 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [941-1098]  3.39999972437719e-72 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [62-487]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1724-1900]  1.10000150671643e-55 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1409-1714]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit