close all open/close all

CDS information : Borre_00200


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction45,514 / 50,742 / + [in whole cluster]
45,514 / 50,742 / + [in contig]
Location45514..50742 [in whole cluster]
45514..50742 [in contig]
TypeCDS
Length5,229 bp (1,742 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)Borrelidin polyketide synthase, type I
Gene
Gene (GenBank)borA6
EC number
Keyword
Note
Note (GenBank)
  • Module 8 (b-ketoacyl-ACP-synthase, acyltransferase, ketoreductase, acylcarrier protein, thioesterase)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
[14651102] Evidence from engineered gene fusions for the repeated use of a module in a modular polyketide synthase. (Chem Commun (Camb). , 2003)

close this sectionPKS/NRPS Module

6 malonyl-CoA
KS37..408
AT556..862
KR1103..1278
ACP1371..1441
TE1522..1730

close this sectionSequence

selected fasta
>polyketide synthase [Borrelidin polyketide synthase, type I]
MTAEASQDKLRDYLRKTLADLRTTKQRLRDTERRATEPVAIVGMSCRLPGDVRTPERFWE
LLDTGTDALTPLPTDRGWNLDTAFDDERPYRREGGFLYDAGRFDAEFFGISPREALAMDP
QQRLLLESSWEAIEHARIDPRSLHGSRTGVWFGTIGQDYFSLFAASGGEHANYLATACSA
SVMSGRVSYVLGLEGPAVTVDTACSSSLVALHSAVQALRSGECELALAGGATVMATPTVF
TAFSHQRGLAGDGRCKAFAAGADGAGFAEGVGVLVLERLSVARRNGHRVLAVVRGSAVNQ
DGASNGLTAPNGPSQQRVIRAALANARLAPEDVDAVEGHGTGTSLGDPIEAQALLATYGR
GRDAERPLWLGSVKSNIGHAQAAAGVAGVIKMVLAMEKGRLPRTLHVDEPSGEVDWDSGA
VRLLTEARDWPSGEGRVRRAGVSSFGISGTNAHVIIEEPQEEEAAPDSSASGAVPWVLSA
RSAEALQALASQLADHSAKSSPVDVGWSLVSTRAAFEHRAVVVGRGRDELVRGLSEVAQG
RGVRGVASSASGGLAFVFAGQGSQRLGMGRGLYERFPVFAEAFDEVCGRVGPGVREVVFG
SDAGELDRTVWAQAGLFALEVALFRLLESWGVRPGCLIGHSVGELSAACVAGLWSLEDAC
RVVAARARLMQALPAGGVMVAVRAEAGELAGFLGEDVVIASVNAPGQVVIAGPEGGVERV
VAACGARSRRLAVSHAFHSPLVEPMLGEFRRVVESVAFGVPSLRVVSNVTGAWVDPEEWG
TPEYWVRQVREPVRFADGVATLLDAGVRTFVELGPAGTLTSMVSHCADATATSVTAVPTL
RPDHDESRTVLSAAASLYVQGHPVDWAPLFPRARTVDLPTYPFQHQHYWMESAARPTVED
TPREPLDGWTHRIDWVPLVDEEPAPVLAGTWLLVRPEEGPRPLADAVADALTRHGASVVE
AARVPHQSDTELTGVVSLLGPGADGDGGLDATLRLVQDLATAGSTAPLWIVTSGAVAVGT
SDTVPNPEQATLWGLARAAATEWPGLGAARIDLPADLTEQVGRRLCARLLDRSEQETAVR
QAGVFARRLVRARTSDGRWTPRGTVLVTGGTGALAGHVARWLAEEGAEHIVLAGRRGPDG
QGAEALRADLVAAGVKATIVRCDVADRDAVRLLLDAHRPSAIVHTAGVVDDGLLTSLTPA
QVERVLRPKLLGARNLHELTRDRELDAFVLFSSLAGVLGGAGQANYAAANAYLDALAAHR
TAHGLPAASLAWGPWEGDGMAAAQEAADRLRRSGLTPLPPEQAVRALGRGHGPLVVADAD
WARLAAGSTQRLLDELPEVRAVRPAEPAVGQRPDLPARLAGRPAEEQSAVLLEAVREEIA
AVLRYADPARIGADHEFLALGFDSLTSIELRNRLATRIGLTLPATLTLEQRTPAGLAAHL
RERIADRPVGSGAVPVPGSADVPEAGGGSGLGELWQEADRHGRRLEFIDVLTAAAAFRPA
YREPAELELPPLRLTSGGDEPPLFCIPSHLGKADPHKFLRFAAALRGRRDVFVLRQPGFV
PGQPLPAGLDVLLDTHARAMAGHDRPVLLGYSAGGLAAQALAARLAELGRPPAAVVLVDT
YAPDETEVMARIQGAMEQGQRDRDGRTGAAFGEAWLTAMGHYFGFDWTPCPVDVPVLHVR
AGDPMTGMPVEGRWQARWNLPHTAVDVPGDHFTMMEDHAPRTADTVHDWLGTAVRRPERT
RD
selected fasta
>polyketide synthase [Borrelidin polyketide synthase, type I]
ATGACGGCCGAAGCGTCTCAGGACAAGCTGCGTGACTATCTGCGAAAGACCCTCGCCGAC
CTGCGGACCACCAAGCAACGGCTACGCGACACCGAACGCAGGGCGACCGAGCCTGTCGCG
ATCGTCGGCATGAGCTGCCGACTGCCCGGCGACGTACGGACACCGGAGCGGTTCTGGGAA
CTCCTCGACACTGGAACCGACGCCCTGACGCCCTTGCCCACCGACCGCGGCTGGAATCTC
GACACGGCGTTCGACGACGAACGGCCGTACCGGCGCGAAGGCGGATTCCTTTACGACGCC
GGACGGTTCGACGCCGAGTTCTTCGGCATCTCGCCCCGTGAGGCGCTGGCCATGGACCCT
CAGCAGCGGCTGCTCCTCGAAAGCTCGTGGGAGGCGATCGAGCACGCCCGCATCGACCCC
AGGTCCCTGCACGGCAGTCGCACCGGCGTCTGGTTCGGCACGATCGGCCAGGACTACTTC
TCCCTCTTCGCCGCATCCGGCGGCGAGCACGCCAACTACTTGGCCACCGCCTGCTCGGCC
AGCGTGATGTCCGGCCGCGTCTCGTACGTGCTCGGCCTGGAGGGGCCCGCTGTCACGGTC
GACACGGCGTGCTCGTCCTCCCTGGTCGCCCTCCACTCCGCCGTACAGGCCCTGAGGTCC
GGCGAGTGCGAACTGGCTCTCGCCGGGGGCGCCACGGTCATGGCCACCCCGACGGTGTTC
ACCGCCTTCTCCCATCAGCGTGGCCTGGCCGGTGACGGCCGCTGCAAGGCCTTCGCGGCG
GGTGCCGACGGGGCGGGCTTCGCCGAGGGGGTGGGCGTGCTGGTGCTGGAGCGGTTGTCG
GTGGCGCGGCGGAACGGTCATCGGGTGTTGGCGGTGGTGCGGGGTTCGGCGGTGAACCAG
GACGGTGCGTCGAACGGTCTGACGGCGCCGAACGGTCCGTCGCAGCAGCGGGTGATCCGC
GCGGCGCTGGCCAACGCGCGCTTGGCGCCGGAGGACGTGGACGCTGTCGAAGGCCACGGC
ACGGGGACTTCGCTGGGCGACCCGATCGAGGCGCAGGCGTTGCTGGCGACGTACGGGCGG
GGCCGGGACGCGGAGCGTCCGTTGTGGCTGGGGTCGGTGAAGTCGAACATCGGTCATGCG
CAGGCTGCTGCCGGTGTCGCCGGTGTCATCAAGATGGTGCTGGCCATGGAGAAGGGCCGT
CTCCCTCGGACGCTGCATGTGGATGAGCCGTCGGGTGAGGTGGACTGGGACTCGGGTGCG
GTACGGCTGCTGACCGAGGCGCGGGACTGGCCGTCGGGGGAGGGGCGGGTGCGGCGGGCG
GGAGTGTCGTCGTTCGGGATCTCCGGGACGAACGCGCACGTGATCATCGAGGAGCCGCAG
GAGGAGGAAGCGGCACCGGATTCCTCTGCTTCGGGTGCCGTGCCGTGGGTGCTCTCGGCG
CGATCGGCCGAAGCGTTGCAGGCTCTGGCTTCACAACTCGCCGACCACAGCGCCAAATCG
AGTCCGGTGGATGTGGGTTGGTCGTTGGTTTCGACGCGTGCGGCGTTCGAGCATCGGGCC
GTGGTGGTGGGGCGCGGGCGGGACGAGTTGGTGCGGGGCTTGTCCGAGGTCGCGCAGGGT
CGGGGCGTGAGGGGTGTCGCGTCTTCGGCGTCGGGTGGTCTCGCGTTTGTTTTTGCTGGT
CAGGGCAGTCAGCGGTTGGGGATGGGGCGGGGGTTGTATGAGCGGTTCCCGGTGTTTGCC
GAGGCGTTCGACGAGGTGTGTGGGCGGGTCGGTCCGGGGGTGCGGGAGGTTGTTTTCGGT
TCGGATGCGGGTGAGTTGGACCGGACGGTGTGGGCGCAGGCGGGGTTGTTCGCGTTGGAG
GTGGCGCTGTTTCGGTTGTTGGAGTCCTGGGGTGTGCGGCCGGGTTGTCTGATCGGGCAT
TCGGTCGGTGAGTTGTCGGCGGCGTGTGTGGCGGGGTTGTGGTCGTTGGAGGATGCGTGT
CGGGTCGTGGCTGCCCGGGCGCGGTTGATGCAGGCGTTGCCGGCGGGTGGGGTGATGGTC
GCGGTTCGGGCCGAGGCGGGGGAGCTGGCCGGTTTCCTCGGTGAGGACGTGGTGATCGCG
TCGGTGAACGCGCCGGGGCAGGTGGTGATCGCTGGTCCTGAGGGGGGTGTGGAGCGTGTG
GTGGCTGCTTGTGGGGCGCGGTCGCGTCGTCTGGCGGTCTCGCATGCTTTTCATTCGCCT
TTGGTGGAGCCGATGCTGGGGGAGTTCCGTCGGGTTGTGGAGTCGGTGGCGTTCGGTGTG
CCGTCGTTGCGGGTGGTTTCCAATGTCACGGGTGCGTGGGTGGATCCGGAGGAGTGGGGG
ACGCCGGAGTACTGGGTGCGTCAGGTCCGTGAGCCGGTGCGTTTCGCCGACGGGGTCGCC
ACGTTGCTCGACGCGGGTGTGAGGACGTTCGTCGAGCTGGGTCCCGCTGGGACGCTCACT
TCGATGGTCAGCCACTGCGCGGACGCCACCGCCACTTCGGTGACGGCTGTACCTACCCTG
CGCCCCGATCACGACGAGTCGCGGACCGTGTTGAGTGCCGCAGCGTCCTTGTACGTCCAG
GGTCACCCGGTCGACTGGGCCCCGCTGTTCCCGCGGGCCCGCACGGTGGACCTGCCCACC
TACCCCTTCCAGCACCAGCACTACTGGATGGAAAGCGCCGCCCGGCCCACCGTCGAGGAC
ACCCCGCGCGAGCCCCTCGACGGCTGGACGCACCGCATCGACTGGGTGCCGCTGGTGGAC
GAGGAACCGGCGCCCGTCCTGGCCGGTACCTGGCTGCTCGTTCGTCCCGAAGAAGGTCCC
CGCCCGCTCGCCGACGCCGTCGCGGACGCGCTGACCCGGCACGGCGCCTCCGTCGTCGAG
GCCGCTCGTGTCCCGCACCAATCCGACACCGAGCTGACCGGAGTCGTCTCTCTGCTGGGC
CCGGGCGCCGACGGCGACGGCGGCCTGGACGCGACCCTGCGGCTGGTACAGGACTTGGCC
ACCGCCGGGTCCACCGCGCCCTTGTGGATCGTCACCAGCGGAGCCGTGGCCGTCGGTACG
TCCGACACCGTGCCGAACCCCGAGCAGGCGACGCTCTGGGGGTTGGCCCGGGCGGCGGCC
ACCGAGTGGCCCGGCCTGGGGGCGGCGCGCATCGACCTGCCCGCCGACCTCACCGAGCAG
GTCGGACGTCGGCTCTGCGCCCGGCTGCTCGACCGGAGTGAGCAGGAGACGGCGGTCCGA
CAGGCCGGGGTGTTCGCCAGGCGGCTGGTCCGTGCCCGTACCAGCGACGGCCGGTGGACG
CCGCGCGGCACCGTGCTGGTCACCGGCGGGACCGGCGCGCTCGCCGGACACGTCGCGCGA
TGGCTGGCGGAGGAGGGGGCCGAGCACATCGTGCTGGCCGGGCGCAGAGGGCCCGACGGT
CAGGGCGCCGAGGCGCTGCGCGCCGACCTGGTCGCCGCAGGGGTCAAGGCGACGATCGTG
CGCTGCGACGTCGCCGACCGGGATGCCGTACGTCTGCTCCTGGACGCACACCGGCCCAGC
GCCATCGTGCACACGGCCGGGGTCGTCGACGACGGACTGCTCACCTCGCTGACGCCCGCC
CAGGTCGAGCGGGTGCTGCGGCCCAAGCTGCTCGGCGCCAGGAACCTGCATGAGCTGACC
CGGGACCGGGAACTGGACGCCTTCGTGCTGTTCTCCTCCCTCGCCGGAGTCCTCGGCGGG
GCAGGGCAGGCCAACTACGCCGCTGCCAACGCCTACTTGGACGCCCTGGCCGCACACCGC
ACCGCGCATGGGCTGCCGGCGGCCTCGCTGGCATGGGGGCCGTGGGAGGGCGACGGCATG
GCCGCGGCGCAGGAGGCCGCCGACCGGCTCCGCCGCAGCGGTCTCACCCCGCTGCCGCCG
GAGCAGGCCGTACGGGCCCTCGGCCGGGGCCACGGGCCGCTGGTGGTGGCCGACGCGGAC
TGGGCGCGGCTGGCCGCCGGCTCGACGCAGCGCCTGCTCGACGAGCTTCCCGAGGTGCGT
GCGGTCAGGCCGGCGGAGCCTGCTGTCGGACAGCGCCCCGACCTACCGGCCCGGTTGGCG
GGGCGTCCGGCCGAGGAGCAGTCCGCGGTACTGCTGGAGGCGGTCCGGGAGGAGATCGCC
GCCGTACTGCGTTACGCCGATCCGGCGCGGATCGGCGCCGATCACGAGTTCCTCGCCCTC
GGCTTCGACTCGCTGACATCGATCGAACTGCGCAACAGGCTTGCCACGCGCATCGGTCTG
ACGCTTCCCGCGACGCTCACCCTGGAACAGCGCACCCCTGCCGGGCTCGCCGCGCACCTG
CGCGAGCGGATCGCGGACCGGCCCGTCGGGTCCGGTGCCGTCCCGGTGCCCGGGAGCGCT
GATGTCCCGGAGGCGGGCGGCGGTAGCGGCCTCGGTGAGCTGTGGCAGGAAGCCGACCGG
CACGGCCGGCGGCTGGAGTTCATCGACGTACTCACCGCGGCCGCCGCCTTCCGGCCCGCC
TACCGTGAACCGGCCGAGCTGGAGCTGCCGCCTCTACGGCTCACCTCCGGCGGGGACGAG
CCGCCCCTGTTCTGCATCCCCTCGCACCTCGGCAAGGCCGACCCGCACAAGTTCCTGCGG
TTCGCCGCGGCCCTGCGGGGACGGCGGGACGTCTTCGTCCTGCGCCAGCCCGGCTTCGTA
CCCGGGCAGCCCCTGCCCGCGGGCCTCGACGTCCTGCTCGACACCCACGCGCGGGCCATG
GCCGGGCACGACCGGCCCGTGCTGCTCGGCTACTCGGCCGGCGGTCTTGCCGCGCAGGCG
TTGGCCGCCCGACTCGCCGAGCTCGGCAGGCCGCCGGCGGCCGTCGTGCTCGTCGACACC
TATGCCCCCGACGAGACGGAGGTGATGGCCCGTATCCAGGGCGCCATGGAGCAGGGCCAG
CGCGATCGCGACGGCAGGACCGGTGCCGCCTTCGGTGAGGCCTGGCTCACCGCGATGGGC
CACTACTTCGGCTTCGACTGGACCCCGTGTCCGGTCGACGTGCCGGTGCTGCACGTACGC
GCCGGCGACCCCATGACCGGTATGCCCGTCGAAGGGCGGTGGCAGGCGCGCTGGAACCTG
CCGCACACCGCCGTCGACGTGCCCGGAGACCACTTCACGATGATGGAGGATCACGCCCCG
CGCACCGCCGACACCGTGCACGACTGGCTCGGCACGGCCGTCCGCCGCCCTGAGAGAACC
CGCGACTGA
[6] KS37..408
[6] AT556..862
[6] malonyl-CoA735..739
[6] KR1103..1278
[6] ACP1371..1441
[6] TE1522..1730
[6] KS109..1224
[6] AT1666..2586
[6] malonyl-CoA2203..2217
[6] KR3307..3834
[6] ACP4111..4323
[6] TE4564..5190

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [1522-1730]  1.3e-25 PF00975
PF00975   Thioesterase
IPR001227 Acyl transferase domain (Domain)
 [548-673]  1.9e-80 G3DSA:3.40.366.10 [735-853]  1.9e-80 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1399-1414]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1363-1458]  1.29999924468179e-19 SSF47336
SSF47336   ACP_like
 [1373-1440]  3.5e-11 PF00550
PF00550   PP-binding
 [1371-1446]  4.6e-18 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1371-1441]  PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [1103-1277]  5.00000000000001e-63 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [37-281]  3.19999999999996e-85 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [290-408]  8.89999999999994e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [556-862]  2.1e-62 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [5-30]  6.3e-07 PF08990
PF08990   Docking
 [2-37]  1.40000045763982e-06 SSF101173
SSF101173   Polyketide_synth_docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [553-845]  3.99998544139406e-74 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [675-734]  1.09999909120787e-12 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [39-294]  1.99999999999999e-89 G3DSA:3.40.47.10 [295-462]  3.19999999999996e-65 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [29-406]  8.19994104549873e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1103-1284]  6.6999999999999e-42 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [195-211]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [557-844]  1.09999184471405e-114 SM00827
SM00827   PKS_AT
IPR020802 Polyketide synthase, thioesterase domain (Domain)
 [1524-1730]  2.89997807423187e-108 SM00824
SM00824   PKS_TE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1372-1444]  5.39999384454126e-27 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [39-461]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1103-1278]  7.0999832511256e-55 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit