close all open/close all

CDS information : Borre_00210


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction50,739 / 52,019 / + [in whole cluster]
50,739 / 52,019 / + [in contig]
Location50739..52019 [in whole cluster]
50739..52019 [in contig]
TypeCDS
Length1,281 bp (426 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)putative cytochrome P450
Gene
Gene (GenBank)borI
EC number
Keyword
  • nitrile
Note
Note (GenBank)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
[15186422] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: insights into nitrile formation. (Mol Microbiol. , 2004)
Related Reference
ACC
Q59831
PmId
[7557483] Cloning, characterization and expression of the gene encoding cytochrome P-450sca-2 from Streptomyces carbophilus involved in production of pravastatin, a specific HMG-CoA reductase inhibitor. (Gene. , 1995)

close this sectionSequence

selected fasta
>putative cytochrome P450 [putative cytochrome P450]
MTTRRRQRHPALSPSCPSVPFPLLETEFVLMPSFPVRRSVPDTPPAEHLELLKESGGVCP
FTMEDGRPAWLAASHDAVRSLLADRRISNNPAKTPPFSQREALQKERGQFSRHLFNMDSP
EHDVARRMIAEDFTPRHAEAVRPYFEEVFGEIVDEVVHKGPPAEMIESFAFPVATRTICK
VLDIPEDDCEYFQKRTEQIIEMDRGEENLEAVVELRRYVDSVMQQRTRKPGDDLLSRMIV
KAKASKEIELSDADLVDNAMFLLVAGHEPSANMLGLGVLALAEFPDVAEELRAEPHLWPG
AIDEMLRYYTIARATKRVAAADIEYEGHTIKEGDAVIVLLDTSNRDPKVHAEPNRLDIHR
SAGNHLAFSHGPHQCLGKHLVRVQLEIALRAVAERLPGLRLDIAKEDIPFRGDALSYGPR
QLRVTW
selected fasta
>putative cytochrome P450 [putative cytochrome P450]
CTGACGACTCGCCGGCGACAGCGGCATCCCGCCCTGTCCCCTTCCTGTCCGTCCGTTCCC
TTTCCTCTCCTCGAAACGGAGTTCGTTCTCATGCCTTCCTTCCCCGTACGCCGGTCCGTG
CCCGACACTCCGCCCGCCGAGCACCTCGAACTGCTCAAGGAGAGCGGCGGCGTCTGCCCC
TTCACCATGGAGGACGGCCGTCCGGCCTGGCTCGCGGCCAGCCACGACGCCGTGCGCTCC
CTGCTCGCCGACCGCCGTATCAGCAACAACCCGGCGAAGACGCCGCCCTTCTCGCAGCGG
GAGGCCCTGCAGAAGGAGCGGGGCCAGTTCAGCCGTCACCTGTTCAACATGGACTCGCCG
GAGCACGACGTGGCCCGCCGCATGATCGCGGAGGACTTCACTCCCCGGCACGCCGAGGCG
GTCCGGCCGTACTTCGAGGAGGTGTTCGGCGAGATCGTCGACGAAGTGGTCCACAAGGGC
CCACCGGCCGAGATGATCGAGTCGTTCGCCTTCCCGGTCGCCACCCGCACCATCTGCAAG
GTGCTGGACATTCCGGAGGACGACTGCGAGTACTTCCAGAAGCGCACCGAGCAGATCATC
GAGATGGACCGCGGCGAGGAGAACCTCGAAGCCGTCGTCGAACTGCGCCGCTACGTCGAC
AGCGTCATGCAGCAGCGCACCCGCAAGCCCGGCGACGACCTGCTCAGCAGGATGATCGTC
AAGGCGAAGGCGTCCAAGGAGATCGAGCTCAGCGACGCCGACCTGGTCGACAACGCGATG
TTCCTGCTGGTGGCCGGGCACGAGCCGTCGGCCAACATGCTGGGCCTCGGCGTGCTCGCC
CTCGCCGAATTCCCGGACGTGGCCGAGGAACTGCGGGCCGAGCCGCACCTGTGGCCGGGC
GCGATCGACGAGATGCTCCGCTACTACACCATCGCCCGGGCCACCAAGCGGGTCGCGGCC
GCCGACATCGAGTACGAGGGGCACACGATCAAGGAGGGGGACGCCGTCATCGTGCTCCTC
GACACCAGCAACCGCGACCCGAAGGTGCACGCCGAACCGAACCGGCTCGACATCCACCGC
TCGGCGGGCAACCACCTGGCCTTCAGCCACGGACCGCACCAGTGCCTGGGCAAGCACCTC
GTCCGGGTCCAACTGGAGATCGCGCTGCGGGCTGTCGCCGAGCGGCTGCCCGGCCTGCGC
CTGGACATCGCCAAGGAGGACATCCCCTTCCGCGGTGACGCCCTGTCCTACGGGCCGCGC
CAGCTGCGCGTCACCTGGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [265-282]  3.1999989904635e-05 PR00385 [300-311]  3.1999989904635e-05 PR00385 [366-375]  3.1999989904635e-05 PR00385 [375-386]  3.1999989904635e-05 PR00385
PR00385   P450
 [38-426]  1.9e-97 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [18-426]  2.50000909916183e-87 SSF48264
SSF48264   Cytochrome_P450
 [184-392]  9.20000000000002e-24 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [117-128]  3.10001307370206e-43 PR00359 [164-180]  3.10001307370206e-43 PR00359 [181-196]  3.10001307370206e-43 PR00359 [217-239]  3.10001307370206e-43 PR00359 [300-311]  3.10001307370206e-43 PR00359 [317-344]  3.10001307370206e-43 PR00359 [345-360]  3.10001307370206e-43 PR00359 [366-375]  3.10001307370206e-43 PR00359 [375-386]  3.10001307370206e-43 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [368-377]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit