close all open/close all

CDS information : Borre_00220


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction52,113 / 53,477 / + [in whole cluster]
52,113 / 53,477 / + [in contig]
Location52113..53477 [in whole cluster]
52113..53477 [in contig]
TypeCDS
Length1,365 bp (454 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative aminotransferase
Product (GenBank)putative aminotransferase
Gene
Gene (GenBank)borJ
EC number2.6.1.-
Keyword
  • nitrile
Note
Note (GenBank)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
[15186422] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: insights into nitrile formation. (Mol Microbiol. , 2004)
Related Reference
ACC
P53555
PmId
[15880481] Removing a bottleneck in the Bacillus subtilis biotin pathway: bioA utilizes lysine rather than S-adenosylmethionine as the amino donor in the KAPA-to-DAPA reaction. (Biotechnol Bioeng. , 2005)

close this sectionSequence

selected fasta
>putative aminotransferase [putative aminotransferase]
MEKTDVDRLRTLDREHMWYPWTPMTEWMARDQLVVERAEGCWLIDADGKRYLDGRSSMGM
NLHGHGRSEIVEALVAQARKAGETTLYRVSHPAAVELAARLASMAPAGLQRVFFAESGST
AVETALKAAYAYWVAKGEPQRSTFVSMEGGYHGETLGTVSLRGTNGEQVDMIRKTYEPLL
FPSLSFHQPHCYRCPVGQSSDSDCGLECTDSLENLLTREKGRIAAVIVEPRVQALAGVIT
APEGHLAKVAEITRRHGVLLIVDEVLTGWARTGPTFSCEAEGVTPDLMTVGKALTGGYLP
LSATLATEEIFGAFRESVFLSGSTYSGYALGAAVALASLDLFEKEDVPARAKALADVLTT
ALEPFRALTHVGDVRQLGLIAGVELVADRETRAPYPPQERVVDRICTLARDNGVLVNAVP
GDVITMLPSPSMSPDDLRFLTGTLYTAVREVTEE
selected fasta
>putative aminotransferase [putative aminotransferase]
GTGGAGAAGACCGACGTCGACCGGCTGCGCACACTCGACCGAGAGCACATGTGGTACCCG
TGGACGCCGATGACCGAGTGGATGGCCCGTGATCAGCTCGTCGTCGAACGCGCCGAAGGC
TGCTGGCTGATCGACGCAGACGGTAAGCGCTACCTCGACGGCCGCTCGTCGATGGGCATG
AACCTGCACGGCCACGGCCGCAGCGAGATAGTCGAGGCCCTGGTCGCCCAGGCGCGCAAG
GCCGGTGAGACCACGCTCTACCGCGTCTCGCACCCGGCGGCGGTGGAACTCGCCGCCCGC
CTGGCATCGATGGCGCCGGCCGGGCTCCAGCGCGTCTTCTTCGCCGAGTCCGGATCGACC
GCGGTGGAGACGGCTCTCAAGGCTGCCTACGCCTACTGGGTCGCGAAGGGCGAACCGCAG
CGATCCACCTTCGTGTCCATGGAGGGCGGTTACCACGGCGAGACCCTAGGCACGGTCAGC
CTGCGCGGCACCAACGGCGAACAGGTCGACATGATCCGCAAGACCTACGAGCCACTGTTG
TTCCCCTCCCTCTCCTTCCACCAGCCCCACTGCTACCGGTGTCCCGTCGGCCAGTCGTCG
GACAGCGACTGCGGGCTGGAGTGCACCGATTCGCTGGAGAACCTCCTCACCCGGGAGAAG
GGCCGGATCGCCGCGGTCATCGTCGAGCCGCGGGTCCAGGCCCTCGCCGGAGTGATCACC
GCCCCGGAGGGACACCTCGCGAAGGTCGCGGAGATCACCCGCAGGCACGGAGTGCTCCTC
ATCGTCGACGAGGTCCTCACCGGCTGGGCCCGCACCGGCCCGACGTTCTCCTGCGAGGCC
GAGGGCGTCACACCGGATCTGATGACGGTGGGCAAGGCGCTGACCGGCGGATATCTGCCG
CTGTCGGCCACCTTGGCCACGGAGGAGATCTTCGGAGCCTTCCGTGAGAGCGTCTTCCTC
AGCGGCAGCACCTACTCCGGATACGCGCTCGGGGCGGCCGTCGCCCTGGCCAGCCTCGAC
CTGTTCGAGAAGGAGGACGTACCGGCCCGGGCCAAGGCGCTCGCCGACGTGCTCACCACC
GCACTGGAACCCTTCCGCGCGCTCACCCACGTCGGTGACGTCCGGCAGCTCGGCCTCATC
GCCGGCGTCGAGCTGGTGGCCGACCGGGAGACCCGCGCCCCCTACCCGCCCCAGGAGCGC
GTCGTCGATCGCATCTGCACCCTGGCCAGGGACAACGGCGTGCTGGTCAACGCGGTCCCC
GGGGACGTGATCACCATGCTGCCCTCACCGTCGATGAGCCCCGACGACCTGCGCTTCCTC
ACCGGCACCCTGTACACGGCCGTCCGAGAGGTGACCGAAGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005814 Aminotransferase class-III (Family)
 [35-386]  2.50000000000001e-93 PF00202
PF00202   Aminotran_3
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [69-345]  7.99999999999993e-86 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [7-67]  5.49999999999995e-42 G3DSA:3.90.1150.10 [347-453]  5.49999999999995e-42 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [5-451]  8.00002659346736e-123 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit