close all open/close all

CDS information : Borre_00230


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction53,474 / 54,466 / + [in whole cluster]
53,474 / 54,466 / + [in contig]
Location53474..54466 [in whole cluster]
53474..54466 [in contig]
TypeCDS
Length993 bp (330 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)putative oxidoreductase
Gene
Gene (GenBank)borK
EC number
Keyword
  • trans-1,2-CPDA
  • nitrile
Note
Note (GenBank)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
[15186422] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: insights into nitrile formation. (Mol Microbiol. , 2004)
Family/Domain
FD
IPR013154, IPR013149

close this sectionSequence

selected fasta
>putative oxidoreductase [putative oxidoreductase]
MKGLMRAAVIRAWGGPERLTLDRVERPSPPPGWIAVRVEACALNHLDIHVRNGLPGVRLE
LPHVSGGDVVGVVEQATDEAGERLLGSRVLLDPMIGRGILGEHYWGGLAEYVVAPAHNAL
PVPDQDADPARYAALPISYGTAQRMLFSRARLRPGESVLLFGATGGVGVACAQLALRAGA
RIIACSGSPAKLARLRRLGVIDTIDTGTEDVRRRVRELTDGGADLVVDYQGKDTWPVSLR
SARAGGRIVTCGATTGYEATTDLRYVWSRQLDILGSNAWHRDDLHTLVDLVATDALEPVV
HADFPLSRAPEAVAELEERRAFGKVVIRTA
selected fasta
>putative oxidoreductase [putative oxidoreductase]
GTGAAAGGGCTGATGCGGGCGGCCGTCATCCGTGCCTGGGGCGGCCCCGAGCGGCTGACC
CTGGACCGGGTCGAACGGCCGTCACCCCCGCCCGGATGGATCGCCGTACGCGTCGAGGCC
TGCGCCCTGAACCACCTCGACATCCACGTGCGCAACGGGCTTCCGGGCGTACGGCTGGAA
CTCCCGCACGTCTCCGGCGGCGACGTCGTCGGCGTCGTCGAGCAGGCCACCGACGAGGCG
GGGGAGAGACTGCTCGGCAGCCGTGTGCTGCTCGACCCGATGATCGGGCGCGGCATCCTC
GGCGAGCACTACTGGGGCGGGCTCGCCGAGTACGTCGTCGCACCCGCCCACAACGCGCTC
CCCGTCCCCGATCAGGACGCGGACCCGGCACGCTACGCCGCACTGCCCATCTCCTACGGC
ACGGCCCAGCGCATGCTCTTCAGCCGCGCCCGGCTGCGTCCCGGCGAGAGCGTGCTGCTG
TTCGGCGCGACCGGCGGCGTCGGCGTCGCCTGCGCCCAGCTCGCCCTGCGTGCCGGGGCC
CGGATCATCGCCTGCTCCGGATCACCGGCCAAGCTCGCCCGGCTGCGCCGACTCGGCGTG
ATCGACACGATCGACACCGGCACCGAGGACGTACGGCGCAGGGTCCGCGAACTCACGGAC
GGCGGTGCCGACCTGGTCGTCGACTACCAGGGCAAGGACACCTGGCCCGTCTCCCTGCGC
TCGGCGCGCGCCGGCGGCCGCATCGTCACCTGCGGCGCGACCACCGGGTACGAGGCGACG
ACCGACCTGCGCTACGTGTGGTCGCGTCAGCTGGACATCCTCGGCTCCAACGCGTGGCAC
CGCGACGATCTGCACACGCTGGTCGACCTGGTGGCCACCGACGCCCTGGAACCGGTGGTG
CACGCCGACTTCCCACTCTCCCGCGCCCCCGAGGCGGTCGCCGAACTGGAGGAGCGCCGG
GCGTTCGGGAAGGTCGTGATCCGCACGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011032 GroES-like (Domain)
 [5-162]  3.80000697093588e-39 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [166-292]  6.40000000000001e-30 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [31-96]  9.7e-09 PF08240
PF08240   ADH_N
IPR016040 NAD(P)-binding domain (Domain)
 [161-276]  1.2e-32 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit