close all open/close all

CDS information : Borre_00240


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction54,506 / 56,176 / + [in whole cluster]
54,506 / 56,176 / + [in contig]
Location54506..56176 [in whole cluster]
54506..56176 [in contig]
TypeCDS
Length1,671 bp (556 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
ProductGH3 auxin-responsive promoter family protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)borL
EC number
Keyword
  • trans-1,2-CPDA
Note
Note (GenBank)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
Family/Domain
FD
IPR004993

close this sectionSequence

selected fasta
>GH3 auxin-responsive promoter family protein [hypothetical protein]
MTGNTTSAAFLRRTQNALAMQRKICAQPEETAERVFSDILSVSRDTGFGREHGLAGVRTR
QEWRRAVPIRTYDELAPYVERQFSGERRVLTTDDPRAFLRTSGSTGRAKLVPTTDHWRRV
YRGPALYAQWGLYFEQIGTHRLTGDEVLDLSWEPGPIRHRLRGFPVYSITERPVSDDPDD
WNPPWRHARWFTRDAGAATMADLLYGKLLRLAAHDLRLIVSVNPSKIVLLAETLKENAER
LIQDLHDGHGTDRAARPDFLRRLTAAFDRTGGRPLLTDLWPGLRLLVCWNSASAALYGPW
LSRLATGVAALPFSTTGTEGIVTLPVDDHLSAGPLAVDQGHFEFVPWQDLDDGSPLPEDT
PTLGYDELELGADYRLVMSQANGLYRYDVGDVYRVVGAVGATPRLEFLGRAGFQSSFTGE
KLTESDVHTAVMRVLGSERTDHPHFSGIPVWDTPPHYLVAIEWADAHGTLNVQDTARRID
ATLQEVNVEYADKRRSGRLRPLQILPLVPGAFGQIAERRFRQGTAGAQIKHHWLQKDSAF
LDTLRDLDLVRARPGT
selected fasta
>GH3 auxin-responsive promoter family protein [hypothetical protein]
GTGACCGGCAACACCACATCCGCCGCCTTCCTGCGGCGGACACAGAACGCGCTCGCCATG
CAGCGCAAGATATGCGCCCAGCCCGAGGAGACCGCGGAGCGCGTGTTCTCCGACATCCTC
TCGGTGTCACGAGACACCGGCTTCGGCCGCGAACACGGCCTCGCCGGGGTCCGCACCCGC
CAGGAGTGGCGGCGTGCCGTGCCCATCCGCACCTACGACGAACTGGCCCCCTACGTCGAG
CGGCAGTTCTCCGGCGAACGCCGCGTGCTCACCACCGACGACCCCCGCGCCTTCCTGCGC
ACCTCGGGATCGACCGGCCGCGCGAAGCTGGTACCCACCACCGATCACTGGCGCCGTGTC
TACCGCGGACCGGCGCTGTACGCGCAGTGGGGGCTCTACTTCGAACAGATCGGCACGCAT
CGGCTCACCGGCGACGAGGTCCTCGACCTGTCCTGGGAGCCCGGCCCCATCCGGCACCGA
CTGCGCGGCTTCCCCGTCTACAGCATCACCGAGCGCCCCGTGTCGGACGACCCCGACGAC
TGGAACCCGCCGTGGCGTCACGCGAGGTGGTTCACCCGCGATGCCGGTGCCGCGACCATG
GCCGACCTGCTCTACGGCAAACTGCTGCGGCTGGCCGCCCACGACCTGAGACTGATCGTC
TCGGTGAACCCCTCCAAGATCGTCCTGCTCGCCGAGACACTGAAGGAGAACGCCGAACGC
CTGATCCAGGACCTGCACGACGGCCACGGCACGGACCGGGCAGCCCGCCCGGACTTCCTC
CGCCGCCTCACCGCCGCCTTCGACCGCACCGGAGGCCGTCCGCTGCTCACCGACCTGTGG
CCCGGCCTGCGTCTGCTCGTCTGCTGGAACTCCGCCTCCGCGGCGCTGTACGGGCCCTGG
CTGTCCCGGCTCGCGACCGGCGTGGCGGCACTGCCGTTCAGCACCACGGGCACCGAGGGA
ATCGTCACGCTGCCCGTCGACGACCACCTCTCGGCGGGGCCGCTCGCTGTCGACCAGGGG
CATTTCGAATTCGTTCCGTGGCAGGACCTGGACGACGGCAGCCCTCTGCCCGAGGACACC
CCCACCCTCGGCTATGACGAACTCGAACTCGGCGCCGACTACCGGCTCGTCATGAGCCAG
GCCAACGGGCTCTACCGCTACGACGTGGGCGACGTGTACCGCGTCGTCGGAGCGGTCGGC
GCCACGCCACGGCTGGAGTTTCTGGGACGCGCGGGATTCCAGTCCTCCTTCACCGGCGAG
AAGCTCACCGAATCCGATGTGCACACCGCCGTGATGCGGGTCCTCGGCAGCGAACGCACC
GACCACCCGCACTTCTCCGGCATCCCGGTCTGGGACACCCCGCCCCACTACCTCGTCGCC
ATCGAATGGGCTGACGCCCACGGCACGTTGAACGTGCAGGACACAGCCCGCCGCATCGAC
GCGACTCTCCAGGAAGTCAACGTGGAATACGCCGACAAGCGCCGCAGCGGACGACTGCGG
CCCCTGCAGATCCTGCCCCTGGTGCCCGGCGCTTTCGGCCAGATCGCCGAACGAAGGTTC
CGCCAGGGCACCGCGGGAGCCCAGATCAAACACCACTGGCTGCAGAAGGACTCGGCGTTC
CTCGACACGCTGCGCGACCTCGACCTCGTCCGCGCCCGCCCGGGGACGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004993 GH3 auxin-responsive promoter (Family)
 [22-540]  2.90000000000003e-114 PF03321
PF03321   GH3
IPR020845 AMP-binding, conserved site (Conserved_site)
 [98-109]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit