close all open/close all

CDS information : Borre_00250


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction56,181 / 57,098 / + [in whole cluster]
56,181 / 57,098 / + [in contig]
Location56181..57098 [in whole cluster]
56181..57098 [in contig]
TypeCDS
Length918 bp (305 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative oxidoreductase
Product (GenBank)putative dehydrogenase
Gene
Gene (GenBank)borM
EC number
Keyword
  • trans-1,2-CPDA
Note
Note (GenBank)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
Related Reference
ACC
Q65YW9
PmId
[15661012] The sigma54-dependent transcriptional activator SfnR regulates the expression of the Pseudomonas putida sfnFG operon responsible for dimethyl sulphone utilization. (Mol Microbiol. , 2005)

close this sectionSequence

selected fasta
>putative oxidoreductase [putative dehydrogenase]
MRIGFAAPMSGPWATPDTAVHVARTAEQLGYASLWTYQRVLGAPDDSWGEANRSVHDPLT
TLAFLAAHTTGIRLGVAVLIMPLHTPAVLAKQLTTLDLLSGGRLDVGLGNGWAAEEYAAA
GVTPTGLSRRAEDFLACLRALWGEQTVVEHDGPFYRVPPARFDPKPAQSPHPPLLLGGAA
PGALRRAGRLCDGWIASSKAGPAAIRDAITVVRDSAERTGRDPATLRFVCRAPVRLRTRS
APNEPPLTGTAETIRADLAALADTGLTEIFLDPNFDPEIGSPDAPTGDVRHRVDLLLHEL
APANW
selected fasta
>putative oxidoreductase [putative dehydrogenase]
ATGCGCATCGGATTCGCCGCACCCATGTCCGGCCCCTGGGCCACCCCGGACACCGCCGTG
CACGTCGCCCGCACCGCCGAACAGCTCGGATACGCCTCGCTCTGGACCTACCAGCGAGTC
CTCGGCGCGCCCGACGACTCCTGGGGCGAGGCCAACCGCAGCGTCCACGACCCCCTGACC
ACCTTGGCCTTCCTGGCCGCGCACACCACCGGGATCCGGCTCGGTGTCGCCGTTCTGATC
ATGCCGCTGCACACCCCCGCGGTGCTGGCCAAGCAGCTCACCACCCTCGACCTGCTCTCC
GGCGGCCGACTCGACGTGGGCCTCGGCAACGGCTGGGCCGCCGAGGAGTACGCCGCCGCC
GGCGTGACCCCCACCGGGCTCAGCCGCCGCGCCGAGGACTTCCTCGCCTGTCTGCGGGCC
CTGTGGGGTGAGCAGACCGTGGTGGAACACGACGGCCCCTTCTACCGGGTCCCGCCCGCC
CGCTTCGACCCGAAGCCCGCCCAGTCCCCGCACCCGCCGCTGCTCCTGGGCGGCGCCGCG
CCCGGCGCACTGCGCCGCGCCGGCCGCCTGTGCGACGGCTGGATCGCGAGCAGCAAGGCC
GGCCCGGCCGCCATCCGCGACGCCATCACCGTCGTACGCGACAGCGCTGAGCGAACCGGA
CGCGACCCCGCGACCCTGAGGTTCGTCTGCCGCGCCCCGGTCCGGCTGCGGACCCGGTCG
GCCCCCAACGAGCCGCCGCTGACCGGCACCGCGGAGACGATCCGGGCCGATCTCGCCGCG
CTAGCCGACACTGGCCTGACCGAGATCTTCCTGGACCCCAACTTCGACCCCGAGATCGGC
TCACCGGACGCGCCGACCGGCGACGTGCGACACCGCGTTGATCTGCTGCTGCACGAACTG
GCCCCCGCAAACTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011251 Luciferase-like domain (Domain)
 [1-276]  3.79997359309398e-68 SSF51679
SSF51679   Luciferase_like
 [1-282]  5.50000000000008e-72 G3DSA:3.20.20.30
G3DSA:3.20.20.30   Luciferase_like
 [8-237]  1.9e-61 PF00296
PF00296   Bac_luciferase
IPR019921 Luciferase-like, F420-dependent oxidoreductase, Rv2161c, predicted (Domain)
 [21-271]  7.09999999999991e-65 TIGR03619
TIGR03619   F420_Rv2161c
SignalP No significant hit
TMHMM No significant hit