close all open/close all

CDS information : Borre_00260


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction57,112 / 57,858 / + [in whole cluster]
57,112 / 57,858 / + [in contig]
Location57112..57858 [in whole cluster]
57112..57858 [in contig]
TypeCDS
Length747 bp (248 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative fumarylacetoacetate hydrolase family protein
Product (GenBank)putative 2-hydroxyhept-2,4-diene-1,7-dioate isomerase
Gene
Gene (GenBank)borN
EC number
Keyword
  • trans-1,2-CPDA
Note
Note (GenBank)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
Family/Domain
FD
IPR002529

close this sectionSequence

selected fasta
>putative fumarylacetoacetate hydrolase family protein [putative 2-hydroxyhept-2,4-diene-1,7-dioate isomerase]
MLIARAAVGEDRTYARVDTDTGLIHLLAGTPYDEIRPTGETRPLAEARLLAPVEPSKVLV
AGRNYGDVVTPDLVVFMKPSTSVVGPRSTVLLPAEAKQVRYEGELAVVIGRRCKDVPEDT
ADQAVFGYTCANDVTAWDVGEPKGHWTKAKSFDTFCPLGPWIRTDLDPADLVLRTTVNGT
LRQDGSTKEMNRNVRALVSRCSSLMTLLPGDVILTGTPAGAGVLRPGDEVVVEIDGIGSL
ANPIGVAK
selected fasta
>putative fumarylacetoacetate hydrolase family protein [putative 2-hydroxyhept-2,4-diene-1,7-dioate isomerase]
GTGCTGATCGCGCGCGCCGCCGTCGGAGAAGACCGAACGTACGCCCGCGTCGACACGGAC
ACAGGGCTGATCCACCTCCTGGCCGGCACTCCCTACGACGAGATCCGGCCGACCGGCGAA
ACCAGACCGCTTGCCGAGGCCCGCCTGCTCGCACCGGTCGAACCCAGCAAAGTGCTGGTC
GCAGGACGCAATTACGGCGATGTCGTCACACCGGACCTGGTGGTCTTCATGAAGCCGTCC
ACCTCTGTCGTCGGCCCCAGGAGCACCGTCCTGCTGCCGGCGGAGGCCAAGCAGGTCCGG
TACGAGGGAGAACTCGCCGTGGTGATCGGGCGCCGCTGCAAAGACGTCCCCGAAGACACC
GCGGACCAGGCCGTGTTCGGCTACACCTGCGCCAACGACGTCACCGCCTGGGACGTCGGG
GAACCGAAGGGCCACTGGACCAAGGCGAAGAGCTTCGACACATTCTGCCCGCTGGGACCA
TGGATCCGCACCGATCTCGACCCCGCTGACCTCGTCCTGCGCACAACCGTGAACGGCACG
CTGCGCCAGGACGGCTCCACCAAGGAAATGAACAGGAATGTCCGCGCCCTCGTGTCCCGT
TGCAGCTCACTGATGACGCTGCTGCCCGGAGACGTGATCCTCACCGGCACACCGGCGGGC
GCCGGCGTGCTGCGTCCGGGTGACGAGGTCGTCGTCGAGATTGACGGGATCGGTTCGCTC
GCGAATCCGATCGGCGTGGCCAAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002529 Fumarylacetoacetase, C-terminal (Domain)
 [69-244]  1.40000000000001e-57 PF01557
PF01557   FAA_hydrolase
IPR011234 Fumarylacetoacetase, C-terminal-related (Domain)
 [39-245]  1.69998802370953e-65 SSF56529
SSF56529   Fumarylacetoacetase_C-rel
 [49-245]  4.80000000000003e-71 G3DSA:3.90.850.10
G3DSA:3.90.850.10   Fumarylacetoacetase_C-rel
IPR018833 Domain of unknown function DUF2437 (Domain)
 [1-52]  1.8e-13 PF10370
PF10370   DUF2437
SignalP No significant hit
TMHMM No significant hit