close all open/close all

CDS information : Borre_00270


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction57,939 / 59,966 / + [in whole cluster]
57,939 / 59,966 / + [in contig]
Location57939..59966 [in whole cluster]
57939..59966 [in contig]
TypeCDS
Length2,028 bp (675 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productborrelidin-resistant threonine--tRNA ligase
borrelidin-resistant threonyl-tRNA synthetase
Product (GenBank)Threonyl-tRNA synthetase
Gene
Gene (GenBank)borO
EC number6.1.1.3
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
Related Reference
ACC
P0A8M3
PmId
[15507440] A unique hydrophobic cluster near the active site contributes to differences in borrelidin inhibition among threonyl-tRNA synthetases. (J Biol Chem. , 2005)
[25128830] Identification of borrelidin binding site on threonyl-tRNA synthetase. (Biochem Biophys Res Commun. , 2014)
ACC
P18255
PmId
[2115870] Independent genes for two threonyl-tRNA synthetases in Bacillus subtilis. (J Bacteriol. , 1990)

close this sectionSequence

selected fasta
>borrelidin-resistant threonine--tRNA ligase [Threonyl-tRNA synthetase]
MSVIRPTAETERAVVVVPAGTTCADAVTAAKLPRNGPNAIVVVRDPSGALRDLDWTPDSD
VEVEAVALSSEDGLTVLRHSTAHVLAQAVQQLWPEARLGIGPPIENGFYYDFDVERPFQP
EDLERVEQRMKEIIKSGQRFCRREFPDREAARAELAKEPYKLELVDLKGDVDAAEAMEVG
GSDLTIYDNLDARTGDVCWSDLCRGPHLPSTRLIPAFKLLRNAAAYWRGSEKNPQLQRIY
GTAWPTRDELKSHLAALEEAAKRDHRRIGEELDLFAFNKEIGRGLPLWLPNGAIIRDELE
DWARKTERKLGYKRVVTPHITQEDLYYLSGHLPYYAEDLYAPIDIDGEKYYLKPMNCPHH
HMVYKARPHSYRDLPYKVAEYGTVYRFERSGQLHGMMRTRGFSQNDAHIYCTADQAKDQF
LEVMRMHADYYRTLGISDFYMVLALRDSANKDKYHDDEQMWEDAERITREAMEESDIPFQ
IDLGGAAHYGPKVDFMIRAVTGKEFAASTNQVDLYTPQRFGLTYHDSDGTEKPVVVIHRA
PLGSHERFTAYLTEHFAGAFPVWLAPEQVRIIPIVEELTDYAEEVRDMLLDADVRADVDA
GDGRLNAKVRAAVTRKIPLVVVVGRREAEQRTVTVRDRSGEETPMSLEKFVAHVTGLIRT
KSLDGAGHIRPLSKA
selected fasta
>borrelidin-resistant threonine--tRNA ligase [Threonyl-tRNA synthetase]
GTGTCTGTAATCCGTCCCACCGCCGAAACCGAACGCGCAGTCGTGGTGGTCCCGGCTGGG
ACGACGTGCGCCGACGCGGTCACCGCGGCAAAGCTGCCGCGCAATGGCCCCAACGCGATC
GTCGTGGTGCGAGACCCGTCCGGCGCCCTGCGTGACCTCGACTGGACCCCCGATTCCGAC
GTCGAGGTCGAGGCCGTCGCGTTGTCCAGCGAGGACGGCCTCACGGTGCTGCGCCACTCC
ACGGCACACGTACTGGCCCAGGCGGTCCAGCAACTCTGGCCGGAGGCCAGGCTCGGTATC
GGCCCGCCGATCGAGAACGGCTTCTACTACGACTTCGACGTGGAGCGCCCCTTCCAGCCA
GAGGACCTCGAGCGCGTCGAGCAGCGGATGAAGGAGATCATCAAGTCCGGCCAGCGCTTC
TGCCGCCGCGAGTTCCCCGATCGGGAAGCGGCCCGTGCCGAGCTTGCCAAGGAGCCGTAC
AAGCTCGAGCTCGTTGACCTCAAGGGCGACGTGGACGCCGCCGAGGCAATGGAGGTCGGC
GGGAGCGACCTGACGATCTACGACAACCTCGACGCGAGAACTGGAGATGTGTGCTGGTCC
GACCTCTGCCGCGGCCCCCACTTGCCGTCGACCCGCCTGATCCCGGCGTTCAAGCTGCTG
CGCAACGCGGCAGCCTACTGGCGCGGCAGCGAGAAGAACCCCCAACTGCAGCGCATCTAC
GGCACGGCCTGGCCGACCCGCGACGAGCTCAAGTCCCATCTCGCCGCCTTGGAGGAGGCC
GCCAAGCGTGACCACCGCCGCATCGGCGAGGAACTCGACCTCTTCGCGTTCAACAAGGAG
ATCGGCCGCGGCCTGCCGCTGTGGCTGCCCAACGGCGCGATCATCCGCGACGAACTCGAG
GACTGGGCCCGCAAGACCGAACGCAAGCTCGGCTACAAGCGCGTCGTCACCCCGCACATC
ACCCAGGAGGACCTTTACTACCTCTCAGGCCATCTGCCTTACTACGCGGAGGACCTGTAC
GCGCCGATCGACATCGACGGCGAGAAGTACTATCTCAAGCCGATGAACTGCCCGCACCAC
CACATGGTGTACAAGGCGCGCCCGCACAGCTATCGCGACCTGCCCTACAAGGTCGCCGAA
TACGGCACGGTGTACCGATTCGAGCGCAGCGGTCAGCTGCACGGCATGATGCGTACGCGC
GGTTTCAGCCAGAATGACGCGCACATCTACTGCACGGCGGACCAGGCCAAGGACCAGTTC
CTGGAAGTCATGCGCATGCACGCGGACTACTACCGCACTCTGGGGATCAGCGACTTCTAC
ATGGTGCTCGCGCTGCGTGACTCGGCGAACAAGGACAAGTACCACGACGACGAGCAGATG
TGGGAGGACGCTGAGCGGATCACCCGGGAGGCCATGGAAGAGTCCGACATCCCCTTCCAG
ATCGACCTGGGCGGTGCCGCGCACTACGGCCCGAAGGTCGACTTCATGATCCGAGCCGTC
ACCGGCAAGGAGTTCGCCGCCTCCACCAACCAGGTCGACCTGTACACCCCGCAGCGTTTC
GGGCTGACCTACCACGACTCCGACGGCACCGAGAAGCCCGTCGTGGTGATCCATCGCGCT
CCGCTCGGCTCGCACGAGCGCTTCACCGCCTATCTCACCGAGCACTTCGCAGGTGCCTTC
CCGGTGTGGTTGGCGCCGGAGCAGGTCCGGATCATTCCGATCGTGGAGGAACTCACGGAC
TACGCCGAGGAAGTCCGCGACATGCTGCTGGACGCGGACGTGCGTGCCGACGTCGATGCC
GGCGACGGCCGGCTGAATGCCAAGGTACGCGCGGCCGTCACCCGGAAGATCCCGCTCGTC
GTGGTGGTCGGCAGGCGAGAGGCTGAGCAGCGCACCGTAACCGTGCGCGACCGCTCCGGC
GAGGAGACCCCGATGTCCCTGGAGAAGTTCGTGGCCCATGTCACTGGACTCATCAGGACC
AAGAGCCTGGACGGCGCCGGCCACATCCGTCCGCTGTCCAAGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002314 Aminoacyl-tRNA synthetase, class II (G/ H/ P/ S), conserved domain (Domain)
 [296-464]  1.29999999999998e-36 PF00587
PF00587   tRNA-synt_2b
IPR002320 Threonyl-tRNA synthetase, class IIa (Family)
 [352-380]  1e-39 PR01047 [385-408]  1e-39 PR01047 [491-519]  1e-39 PR01047 [534-547]  1e-39 PR01047 [561-573]  1e-39 PR01047
PR01047   TRNASYNTHTHR
 [78-654]  TIGR00418
TIGR00418   ThrS
IPR004154 Anticodon-binding (Domain)
 [558-661]  5.69999999999998e-29 G3DSA:3.40.50.800
G3DSA:3.40.50.800   Anticodon_bd
 [556-660]  1.50000306971104e-28 SSF52954
SSF52954   Anticodon_bd
 [568-654]  1.69999999999999e-19 PF03129
PF03129   HGTP_anticodon
IPR006195 Aminoacyl-tRNA synthetase, class II (Domain)
 [290-561]  PS50862
PS50862   AA_TRNA_LIGASE_II
IPR012947 Threonyl/alanyl tRNA synthetase, SAD (Domain)
 [184-240]  7.99999145876753e-23 SM00863
SM00863   tRNA_SAD
 [193-240]  3.60000000000001e-14 PF07973
PF07973   tRNA_SAD
IPR018163 Threonyl/alanyl tRNA synthetase, class II-like, putative editing domain (Domain)
 [69-262]  1e-53 SSF55186
SSF55186   Thr/Ala-tRNA-synth_IIc_edit
SignalP
 [1-29]  0.546 Signal
Eukaryota   
TMHMM No significant hit