close all open/close all

CDS information : Borre_00280


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction60,533 / 60,153 / - [in whole cluster]
60,533 / 60,153 / - [in contig]
Locationcomplement(60153..60533) [in whole cluster]
complement(60153..60533) [in contig]
TypeCDS
Length381 bp (126 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORFB8
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MVPTMLCMVAVPESHSGWTFVTNHARVLAAIADNPNVRIRDIAAHCRLTERAVQRIISDL
EQDGYLSHTRDGRSNIYRVEPDKVLRHPAEAGLTVAALLSLLVRDETDHGRSAGPGSRPA
RSSAAR
selected fasta
>hypothetical protein [hypothetical protein]
ATGGTCCCTACAATGCTGTGCATGGTTGCAGTGCCTGAATCTCACTCCGGATGGACGTTC
GTCACCAACCACGCGCGTGTACTGGCGGCCATCGCCGACAATCCGAACGTGCGGATCCGC
GACATCGCCGCCCACTGCAGACTCACCGAGCGCGCCGTCCAGCGGATCATCTCGGACCTG
GAGCAGGACGGCTATCTCTCCCACACCCGTGACGGGCGCAGCAACATCTACCGCGTCGAA
CCGGACAAGGTCCTGCGCCACCCGGCGGAAGCGGGCCTCACCGTGGCCGCACTGCTGTCC
CTGCTCGTCCGGGACGAGACCGACCACGGACGGTCGGCCGGTCCCGGCTCCCGTCCGGCC
CGCTCCAGCGCCGCCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [16-80]  1.1e-13 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP
 [1-16]  0.79 Signal
Eukaryota   
TMHMM No significant hit