close all open/close all

CDS information : Borre_00290


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction60,620 / 61,003 / + [in whole cluster]
60,620 / 61,003 / + [in contig]
Location60620..61003 [in whole cluster]
60620..61003 [in contig]
TypeCDS
Length384 bp (127 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORFB9
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MSLDEAVAGCSRHTGRRRLPAAEQPTQAQYEAHGAWVVSARGAYDMNSVEPLADALKDAA
EKSPKVVLDASGITFADSTLLSLLILTHQATDFRVAAPTWQVMRLMQLTGVDAFLKVRAT
VEEAATA
selected fasta
>hypothetical protein [hypothetical protein]
GTGTCTTTGGATGAAGCGGTCGCGGGGTGCTCGCGCCACACCGGCCGGCGTCGGCTCCCG
GCCGCGGAGCAACCCACGCAGGCGCAGTACGAAGCGCACGGCGCCTGGGTCGTCAGCGCA
CGGGGCGCATACGACATGAACTCGGTCGAGCCCTTGGCCGACGCGTTGAAAGACGCGGCC
GAGAAGTCTCCGAAGGTGGTACTGGACGCCTCCGGCATCACCTTCGCCGACTCCACCCTG
CTGAGTCTGCTGATCCTCACCCACCAGGCGACGGACTTCCGGGTGGCCGCGCCGACGTGG
CAAGTGATGCGGCTCATGCAACTGACGGGCGTCGACGCCTTCTTGAAGGTACGGGCCACG
GTGGAAGAGGCCGCCACCGCTTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002645 STAS domain (Domain)
 [33-125]  1e-15 G3DSA:3.30.750.24
G3DSA:3.30.750.24   STAS
 [40-112]  5e-11 PF13466
PF13466   STAS_2
 [34-127]  PS50801
PS50801   STAS
 [22-124]  1e-13 SSF52091
SSF52091   STAS
SignalP
 [1-21]  0.28 Signal
Bacteria, Gram-positive   
TMHMM No significant hit