close all open/close all

CDS information : Borre_00310


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction61,526 / 61,738 / + [in whole cluster]
61,526 / 61,738 / + [in contig]
Location61526..61738 [in whole cluster]
61526..61738 [in contig]
TypeCDS
Length213 bp (70 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORFB11
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MSDTRLRQRDETSKGPATEIPAPQWRDLFLAPDWGGTDEQVIVAEEARGPEHFTGARRPR
GGRRSSRRAA
selected fasta
>hypothetical protein [hypothetical protein]
ATGAGCGATACCCGGCTTCGGCAGCGCGATGAGACGTCGAAGGGGCCGGCCACCGAGATC
CCGGCGCCGCAGTGGCGGGACCTCTTCCTCGCCCCCGACTGGGGCGGCACTGATGAGCAG
GTGATCGTCGCCGAAGAGGCGCGCGGGCCCGAGCACTTCACCGGAGCGCGCCGTCCGCGC
GGCGGCCGCCGATCGAGTCGACGGGCCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit