close all open/close all

CDS information : Borre_00330


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction62,885 / 62,586 / - [in whole cluster]
62,885 / 62,586 / - [in contig]
Locationcomplement(62586..62885) [in whole cluster]
complement(62586..62885) [in contig]
TypeCDS
Length300 bp (99 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productputative acetyltransferase(fragment)
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORFB13b
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
Family/Domain
FD
IPR000182

close this sectionSequence

selected fasta
>putative acetyltransferase(fragment) [hypothetical protein]
VDAEDATDRVLGFYALLLAPAELDLLFVQDGTQGRGIGRLLVDHMKRRARAAGLDRVRVV
SHPPAEGFYRAVGALPTGTARANPPAVAWDRPVLEFLIP
selected fasta
>putative acetyltransferase(fragment) [hypothetical protein]
GTCGACGCCGAGGACGCCACGGACCGGGTGCTCGGCTTCTACGCGCTGCTCCTCGCGCCG
GCGGAGCTGGACCTGCTGTTCGTCCAGGACGGTACCCAGGGCCGCGGCATCGGACGGCTG
CTTGTCGATCACATGAAGAGGCGGGCCCGCGCGGCAGGGCTGGACCGTGTCCGGGTGGTG
TCGCACCCTCCGGCCGAGGGCTTCTACCGCGCTGTGGGCGCCCTGCCCACCGGAACCGCC
CGCGCGAACCCGCCCGCGGTGGCCTGGGACCGACCCGTGCTGGAATTCCTGATCCCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000182 GNAT domain (Domain)
 [1-94]  PS51186
PS51186   GNAT
 [6-73]  3.2e-09 PF13673
PF13673   Acetyltransf_10
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [3-98]  2.09999806691534e-14 SSF55729
SSF55729   Acyl_CoA_acyltransferase
 [4-80]  2.1e-14 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
SignalP
 [1-23]  0.298 Signal
Eukaryota   
TMHMM No significant hit