close all open/close all

CDS information : Borre_00350


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction65,071 / 63,155 / - [in whole cluster]
65,071 / 63,155 / - [in contig]
Locationcomplement(63155..65071) [in whole cluster]
complement(63155..65071) [in contig]
TypeCDS
Length1,917 bp (638 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORFB14
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MAQRRTPFGDRARYWFDSTLARGAAALVGWMALLSLAVVVPASAVMVWTDPDAPPSLAER
LAEVWRLTGETLRLGGATGTPLRAMLSVLLALVTLLYVSTLVGLITTALTERLTSLRRGR
STVLEQGHAVVLGWSEQVFTVVSELVAANVNQRGAAVVVLADRDKTVMEESLGTKVGSCG
GTRLICRSGPTTDPAVLPLTSPATAGVVLVLPPDEPHADAEVVKTLLALRAALAGAKPRP
PVVAAVRDDRYRLAACLAAGPDGVVLESDTVTARLIVQAARRPGISLVHRELLDFAGDEF
YLISEPALTGRPFGEVLLSYSTTSVVGLMRGCTPLLNPPPTTPVAPDDLLVVITGDDDTA
RLDDCAESVEKAAVASRPPTPAPAERILLLGWNRRAPLVVDQLHRRARPGSAVDVVAEPG
EATIREISEAEADSGNGENGGNGLSLALHHGDITRPETLRRLDVHSYDSVIVLGRDPAPG
QPPDDPDNRTLVTLLLLRQLEEATGRELPVVTELIDDRNRALAPIGPGADVIISGKLIGL
LMSQISQNRHLAAVFEELFSAEGAGVRLRPATDYLLPGSTTSFATVVAAARRRGECAIGY
RDHADASTRPHYGVRINPPKRERRRWTAEDEVVVIGTD
selected fasta
>hypothetical protein [hypothetical protein]
GTGGCGCAGCGGCGGACTCCGTTCGGTGACAGGGCCCGTTACTGGTTCGACAGCACCCTG
GCCCGCGGTGCCGCCGCGCTCGTCGGCTGGATGGCGCTGCTGTCCCTGGCCGTCGTCGTG
CCGGCCAGCGCGGTGATGGTGTGGACCGACCCGGATGCCCCGCCGTCCCTCGCGGAGCGG
CTGGCGGAGGTGTGGCGTCTCACCGGGGAGACGCTACGGCTGGGCGGTGCCACGGGTACG
CCGCTGCGGGCGATGTTGTCGGTGCTGCTCGCGCTGGTCACCCTGCTCTACGTCTCCACG
CTCGTCGGCCTGATCACGACGGCGCTCACGGAGCGGCTCACCTCGTTGCGGCGGGGCCGT
TCCACCGTGCTGGAACAGGGGCACGCCGTGGTCCTCGGATGGTCGGAACAGGTCTTCACG
GTGGTGAGCGAGCTGGTGGCCGCCAACGTCAACCAGCGCGGCGCGGCGGTGGTGGTGCTG
GCCGACCGGGACAAGACCGTCATGGAGGAGTCCCTGGGCACGAAGGTGGGCTCCTGCGGC
GGTACGCGGTTGATCTGCCGCAGCGGCCCCACCACCGACCCGGCCGTGTTGCCGTTGACC
AGCCCGGCCACGGCCGGTGTCGTGCTGGTTCTGCCTCCGGACGAGCCGCACGCCGACGCG
GAGGTGGTGAAGACACTGCTGGCGCTGCGGGCCGCTCTGGCCGGGGCGAAACCGCGTCCG
CCCGTCGTCGCCGCCGTCCGGGACGACCGGTACCGCCTGGCCGCCTGTCTCGCCGCCGGA
CCCGACGGCGTCGTCCTGGAGAGTGACACCGTCACCGCCCGGCTGATCGTCCAGGCCGCC
CGCCGCCCCGGGATCTCCCTCGTCCACCGGGAACTCCTCGACTTCGCCGGAGACGAGTTC
TATCTGATCAGCGAGCCGGCCCTGACCGGCCGCCCGTTCGGCGAGGTTCTCCTGTCCTAC
TCGACGACGAGCGTCGTCGGACTGATGCGCGGCTGCACCCCCTTGCTCAACCCGCCGCCG
ACGACGCCGGTCGCCCCGGACGACCTGCTCGTCGTCATCACCGGCGACGACGACACGGCC
CGGCTGGACGACTGTGCGGAGTCGGTCGAGAAGGCCGCGGTGGCCTCCCGCCCTCCGACG
CCCGCGCCGGCGGAGCGGATTCTGCTACTGGGCTGGAACCGCCGAGCGCCGCTCGTGGTC
GACCAGTTGCACCGACGCGCCCGGCCCGGTTCGGCCGTCGACGTCGTGGCGGAACCGGGC
GAGGCGACGATCCGCGAGATCAGCGAGGCCGAAGCGGACAGCGGAAACGGGGAGAACGGT
GGGAACGGCCTGAGCCTGGCTCTGCACCACGGGGACATCACCCGTCCCGAGACGCTGCGG
CGCCTGGACGTCCACTCCTACGACAGCGTGATCGTGCTGGGGCGGGACCCCGCCCCGGGC
CAACCGCCGGACGATCCCGACAACCGCACGCTCGTCACCCTTCTGCTCCTGCGCCAACTG
GAAGAAGCCACCGGGCGCGAGCTGCCGGTCGTCACCGAACTGATCGACGACCGCAACCGG
GCGCTGGCCCCCATCGGCCCCGGGGCCGACGTCATCATCAGCGGCAAGCTCATCGGCCTG
CTCATGTCCCAGATCTCCCAGAACCGGCACCTGGCCGCGGTCTTCGAGGAACTGTTCTCC
GCCGAGGGCGCCGGGGTCCGCCTGCGGCCGGCGACCGACTACCTGTTGCCAGGGAGCACC
ACGTCCTTCGCCACCGTCGTGGCCGCGGCACGCCGTCGCGGCGAGTGCGCCATCGGTTAC
CGCGACCACGCCGACGCGTCGACGCGCCCCCACTACGGAGTGCGGATCAATCCGCCCAAA
CGCGAGCGGCGCCGGTGGACGGCCGAGGACGAGGTGGTCGTCATCGGGACGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006037 Regulator of K+ conductance, C-terminal (Domain)
 [285-368]  PS51202
PS51202   RCK_C
IPR016040 NAD(P)-binding domain (Domain)
 [126-289]  4.10000000000001e-18 G3DSA:3.40.50.720 [386-554]  4.10000000000001e-18 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-49]  0.949 Signal
Bacteria, Gram-positive   
 [1-44]  0.73 Signal
Eukaryota   
 [1-44]  0.861 Signal
Bacteria, Gram-negative   
TMHMM
 [20-42]  Transmembrane (o-i) [88-110]  Transmembrane (i-o)
Transmembrane 2