close all open/close all

CDS information : Borre_00360


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction65,374 / 65,871 / + [in whole cluster]
65,374 / 65,871 / + [in contig]
Location65374..65871 [in whole cluster]
65374..65871 [in contig]
TypeCDS
Length498 bp (165 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORFB15
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MPSTDVVELILRDHRRMEELFRTLRNVEADRAAALTEFADLLIAHASAEEDEVYPALRRY
KNVEGEDVDHSVHEHHEANEALLALLEVEDTASDEWDDKLEELVTAVNHHADEEERTLLN
DARENVADDRRRELGQKFQEARSRYLETGCGSVENVRKLVAAADD
selected fasta
>hypothetical protein [hypothetical protein]
GTGCCGTCCACCGATGTCGTCGAACTCATCCTGCGGGACCACCGCCGTATGGAGGAACTG
TTCCGCACCCTGCGCAACGTCGAAGCGGACCGTGCCGCGGCCCTGACGGAGTTCGCGGAC
CTGCTCATCGCGCACGCCTCGGCCGAGGAGGACGAGGTCTACCCCGCCCTGCGTCGGTAC
AAGAACGTCGAGGGTGAGGATGTCGACCACAGCGTCCACGAGCACCACGAGGCCAACGAG
GCGCTGCTGGCCCTGCTCGAGGTGGAGGACACCGCTTCCGACGAGTGGGATGACAAGCTC
GAAGAGCTGGTCACGGCGGTCAACCACCACGCCGACGAGGAGGAACGAACACTCCTCAAC
GACGCCCGGGAGAACGTCGCCGACGACCGCCGCCGGGAACTGGGGCAGAAGTTCCAGGAG
GCGCGTTCGCGGTATCTGGAGACCGGCTGCGGCAGTGTCGAGAACGTGCGCAAGCTGGTC
GCCGCCGCCGACGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR012312 Haemerythrin/HHE cation-binding motif (Domain)
 [6-119]  1.7e-11 PF01814
PF01814   Hemerythrin
SignalP
 [1-29]  0.055 Signal
Eukaryota   
TMHMM No significant hit