close all open/close all

CDS information : Borre_00370


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction68,293 / 65,942 / - [in whole cluster]
68,293 / 65,942 / - [in contig]
Locationcomplement(65942..68293) [in whole cluster]
complement(65942..68293) [in contig]
TypeCDS
Length2,352 bp (783 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORFB16
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
Related Reference
ACC
A9QH35
PmId
[17921299] Identification of a fourth formate dehydrogenase in Methylobacterium extorquens AM1 and confirmation of the essential role of formate oxidation in methylotrophy. (J Bacteriol. , 2007)

close this sectionSequence

selected fasta
>putative oxidoreductase [hypothetical protein]
MTEGRTRREKGEHMQKPHGEESETSLSVTPPKKWAAGVPAVVHALEYSLEQTSPRRTGVD
LLTMNQVGGIDCPGCAWADPAPGRRHRNEYCENGAKHINDEATTRRVTADFFREHSVADL
AGRSDMWLNQQGRLTEPMIKRPGSAHYEPIGWNDALGVLAEELKSLASPDEAVFYTSGRA
SNEAAFVLQLFARAFGTNNLPDCSNMCHESSGFALSETLGTGKGTVGLDDLHHADLIFLV
GQNPGSNHPRQLSALEEAKRNGARIVAVNPLPEAGLRRFKNPQQPRGVVGRGTRIADRFL
HIKPGGDLALFQALNRLLLEAEDARPGTVLDHDFIDAHTTGFEEFARHARTVDWDDVRAA
TGLTREEIEKVRDEVLDSERVVVCWAMGITQHKHGVPTVREIVNFLMLRGNLGRAGTGAC
PVRGHSNVQGDRTMGIWEQMPDTFLDALRDEFGFEPPRAHGLDSVNSIKAMREGRVKVFL
ALAGNFVRAAPDSEVTEEAMRSCRLTAHISTKLNRSHTVCGDTALILPTLGRTERDVQAD
GEQFVTVENSMSEVHTSRGRLAPASPMLLSEIAILCRLARLTLDGRVEIPWETFEGDYHT
IRDRIARIVPGFHDFNARVTRPGGFQLPNPVNEGVFNTEVGKALFTRNESVVPRAPEGHL
LLQTLRSHDQWNTVPYTDNDRYRGIHGSRHVVLVNPADLSELGLAQGDRVDLVSVWADGT
ERRAENFQVVPYPAAKGSAAAYYPETNVLVPLDSVADISNQPTSKGIVVRLEPVPDRTQP
SPA
selected fasta
>putative oxidoreductase [hypothetical protein]
CTGACCGAGGGCCGGACACGGCGAGAGAAAGGCGAACACATGCAGAAGCCGCACGGTGAG
GAGTCGGAGACCAGCCTCTCCGTGACACCGCCGAAGAAGTGGGCCGCCGGCGTCCCCGCG
GTCGTGCACGCGCTGGAGTACTCCTTGGAGCAGACGTCCCCGCGCAGGACCGGGGTGGAT
CTGCTGACCATGAACCAGGTGGGCGGCATCGACTGCCCCGGCTGCGCGTGGGCGGACCCG
GCCCCGGGACGGCGCCACCGCAACGAGTACTGCGAGAACGGCGCCAAGCACATCAACGAC
GAGGCGACCACACGGCGGGTGACCGCCGACTTCTTCCGCGAGCACAGCGTCGCCGACCTC
GCCGGCCGCTCCGACATGTGGCTCAACCAGCAGGGCCGGCTCACCGAGCCGATGATCAAA
CGGCCCGGCTCCGCGCACTACGAGCCCATCGGCTGGAACGACGCCCTGGGGGTCCTCGCG
GAGGAGCTCAAGTCGCTGGCCTCCCCCGACGAGGCGGTGTTCTACACCTCGGGCCGCGCC
AGCAACGAGGCCGCCTTCGTGCTGCAGCTCTTCGCCCGCGCCTTCGGCACCAACAACCTG
CCCGACTGCAGCAACATGTGCCACGAGTCCAGCGGCTTCGCCCTGAGCGAGACCCTGGGG
ACCGGCAAGGGCACCGTCGGTCTCGACGACCTCCACCACGCCGATCTGATCTTCCTGGTC
GGGCAGAACCCCGGCAGCAACCACCCGCGCCAGCTCAGCGCGCTGGAGGAGGCCAAGCGG
AACGGCGCCCGGATCGTGGCCGTGAACCCGCTTCCCGAGGCCGGGCTGCGACGCTTCAAG
AACCCGCAGCAGCCGCGCGGGGTCGTCGGGCGCGGCACCCGGATCGCCGACCGTTTCCTG
CACATCAAGCCCGGTGGCGACCTCGCCCTCTTCCAGGCCCTCAACCGACTGCTGCTGGAG
GCCGAGGACGCCCGGCCCGGCACCGTCCTGGACCACGACTTCATCGACGCCCACACCACC
GGCTTCGAGGAGTTCGCCCGGCACGCCCGCACGGTGGACTGGGACGACGTGCGCGCGGCG
ACCGGACTGACCCGCGAGGAGATCGAGAAGGTACGCGACGAGGTCCTCGACAGCGAACGC
GTCGTCGTCTGCTGGGCGATGGGCATCACCCAGCACAAGCACGGCGTGCCCACCGTCCGG
GAGATCGTCAACTTCCTGATGCTCCGCGGCAACCTGGGACGCGCCGGCACCGGCGCCTGC
CCGGTGCGCGGCCACAGCAACGTCCAGGGCGACCGCACCATGGGCATCTGGGAGCAGATG
CCGGACACCTTCCTGGACGCCCTGCGGGACGAGTTCGGCTTCGAGCCGCCGCGGGCCCAC
GGCCTGGACTCGGTGAACTCGATCAAGGCAATGCGCGAGGGCCGCGTCAAGGTCTTCCTC
GCCCTGGCCGGGAACTTCGTCCGGGCGGCGCCCGACAGCGAGGTCACCGAGGAGGCGATG
CGCTCGTGCCGGCTGACCGCCCACATCTCGACCAAGCTCAACCGCTCGCACACCGTCTGC
GGTGACACCGCGTTGATCCTGCCGACGCTGGGACGCACCGAGCGCGACGTCCAGGCCGAC
GGCGAGCAGTTCGTCACCGTCGAGAACTCCATGAGCGAGGTGCACACCTCCCGGGGCCGC
CTGGCCCCCGCCTCCCCCATGCTGCTGAGCGAGATCGCGATCCTGTGCCGGCTCGCCCGG
CTCACCCTGGACGGCAGGGTGGAGATCCCCTGGGAGACCTTCGAAGGCGACTACCACACC
ATCCGCGACCGCATCGCGCGCATCGTGCCCGGCTTCCACGACTTCAACGCACGCGTGACC
CGGCCCGGTGGCTTCCAACTGCCCAACCCGGTCAACGAAGGCGTCTTCAACACCGAGGTC
GGCAAGGCCCTGTTCACTCGCAACGAGAGCGTGGTCCCACGGGCGCCCGAAGGTCATCTG
CTGCTGCAGACACTGCGTTCGCACGACCAGTGGAACACCGTCCCCTACACCGACAACGAT
CGCTACCGCGGCATCCACGGCAGCCGCCACGTCGTCCTCGTCAACCCGGCCGACCTGAGC
GAACTCGGCCTCGCCCAGGGCGATCGCGTCGACCTCGTGAGCGTCTGGGCGGACGGCACC
GAGCGCCGGGCCGAGAACTTCCAGGTCGTTCCCTACCCGGCGGCCAAGGGCTCGGCCGCC
GCCTACTATCCCGAGACCAACGTCCTGGTACCGCTGGACAGCGTCGCGGACATCAGCAAT
CAGCCCACGTCCAAGGGCATCGTCGTCCGCCTCGAACCCGTCCCGGACCGGACGCAGCCC
TCACCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006656 Molybdopterin oxidoreductase (Domain)
 [133-501]  4.29999999999998e-24 PF00384
PF00384   Molybdopterin
IPR006657 Molydopterin dinucleotide-binding domain (Domain)
 [660-766]  1.2e-09 PF01568
PF01568   Molydop_binding
IPR009010 Aspartate decarboxylase-like fold (Domain)
 [660-774]  6.2e-11 G3DSA:2.40.40.20
G3DSA:2.40.40.20   Asp_decarboxylase-like_fold
 [652-774]  7.89999609889417e-18 SSF50692
SSF50692   Asp_decarb_fold
IPR010046 Oxidoreductase alpha (molybdopterin) subunit (Family)
 [35-773]  TIGR01701
TIGR01701   Fdhalpha-like
 [9-779]  PIRSF000144
PIRSF000144   CbbBc
SignalP
 [1-44]  0.148 Signal
Bacteria, Gram-negative   
TMHMM No significant hit