close all open/close all

CDS information : Borre_00380


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction68,823 / 68,290 / - [in whole cluster]
68,823 / 68,290 / - [in contig]
Locationcomplement(68290..68823) [in whole cluster]
complement(68290..68823) [in contig]
TypeCDS
Length534 bp (177 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
ProductStreptomyces cyclase/dehydrase family protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORFB17
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
Family/Domain
FD
IPR005031

close this sectionSequence

selected fasta
>Streptomyces cyclase/dehydrase family protein [hypothetical protein]
MRERHVDQTVEVAVPVRTAYNQWTQFKSFPRFSAVVRDVEQVRPTVTAWTLGYGPLRRRF
AVEILEQDPDAYLAWRGLEQRPWHRGEVEFRPTESGGTAITVRVLLEPRGAARILTRSSR
AVRLTTRLVHGELTRFKRFMEGLGQEGGAWRGTIRNGRVQHDRPEPPRSRVARWPVG
selected fasta
>Streptomyces cyclase/dehydrase family protein [hypothetical protein]
CTGCGCGAGCGGCACGTCGACCAGACGGTCGAGGTGGCGGTGCCCGTACGGACGGCGTAC
AACCAGTGGACGCAGTTCAAGTCCTTCCCTCGGTTCTCGGCCGTGGTCCGCGACGTCGAG
CAGGTCCGGCCCACCGTGACCGCCTGGACCCTCGGTTACGGCCCCCTGCGCCGCCGCTTC
GCGGTCGAGATCCTGGAGCAGGACCCCGACGCCTACCTGGCCTGGCGCGGCCTGGAGCAG
AGGCCGTGGCACCGGGGAGAGGTCGAGTTCAGGCCGACGGAGTCCGGCGGCACCGCGATC
ACCGTCCGGGTGCTTCTGGAACCGCGGGGAGCCGCGAGGATCCTCACCCGTTCCTCGCGG
GCGGTCCGGCTGACCACCCGACTGGTCCACGGCGAGCTGACGAGATTCAAACGGTTCATG
GAGGGACTGGGACAAGAGGGCGGCGCCTGGCGCGGCACCATCCGCAACGGCCGCGTGCAA
CACGATCGACCGGAACCGCCCAGGAGCAGGGTGGCCCGGTGGCCCGTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005031 Streptomyces cyclase/dehydrase (Family)
 [12-115]  9.40000000000003e-10 PF03364
PF03364   Polyketide_cyc
SignalP No significant hit
TMHMM No significant hit