close all open/close all

CDS information : Borre_00390


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction69,681 / 70,436 / + [in whole cluster]
69,681 / 70,436 / + [in contig]
Location69681..70436 [in whole cluster]
69681..70436 [in contig]
TypeCDS
Length756 bp (251 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORFB18
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MLLLISPDGVEEALDCAKAAEHLDIVDVKKPDEGSLGANFPWVIREIRDAVPADKPVSAT
VGDVPYKPGTVAQAALGAVVSGATYIKVGLYGCTTPEQGIAVMRAVVRAVKDHRPEALVV
ASGYADAHRIGCVNPLALPDIAARSGADAAMLDTAVKDGTRLFDHVPPDTCAEFVRRAHA
AGLLAALAGSVRQTDLGRLTRIGTDIVGVRGAVCEGGDRNAGRIRPHLVAAFRSEMDRHA
REHRAGVTTAS
selected fasta
>hypothetical protein [hypothetical protein]
GTGTTGCTTCTCATCTCTCCGGACGGTGTCGAGGAAGCCCTCGACTGCGCGAAGGCGGCG
GAGCACCTCGACATCGTCGACGTGAAGAAGCCCGACGAGGGCTCGCTGGGCGCGAACTTC
CCGTGGGTCATCAGGGAGATCCGCGACGCGGTGCCGGCGGACAAGCCGGTCTCGGCCACC
GTGGGGGACGTCCCGTACAAGCCCGGCACGGTGGCGCAGGCCGCGCTGGGCGCGGTCGTC
TCGGGGGCCACGTACATCAAGGTCGGCCTCTACGGATGCACGACGCCCGAACAGGGCATC
GCGGTCATGCGCGCGGTGGTCCGGGCGGTGAAGGACCACCGTCCCGAAGCGCTCGTCGTC
GCGTCCGGTTACGCCGACGCCCACCGGATCGGCTGCGTCAACCCGCTCGCCCTGCCCGAC
ATCGCCGCCCGCTCCGGCGCCGACGCCGCGATGCTCGACACCGCGGTCAAGGACGGGACG
CGGCTGTTCGATCACGTTCCGCCGGACACCTGCGCCGAGTTCGTCCGTCGCGCCCACGCC
GCCGGCCTGCTCGCCGCCCTCGCGGGCAGCGTCAGGCAGACCGACCTCGGCCGGCTGACC
CGGATCGGCACGGACATCGTCGGGGTGCGCGGAGCGGTCTGCGAGGGCGGCGACCGCAAC
GCCGGACGCATCCGGCCGCACCTGGTGGCCGCCTTCCGGAGCGAGATGGACCGGCACGCC
CGCGAGCACCGGGCCGGCGTCACCACCGCGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007565 Uncharacterised protein family UPF0264 (Family)
 [1-237]  3.19999999999996e-122 PF04476
PF04476   DUF556
 [1-245]  PIRSF015957
PIRSF015957   UCP015957
IPR011060 Ribulose-phosphate binding barrel (Domain)
 [1-240]  8.70000305989074e-07 SSF51366
SSF51366   RibP_bind_barrel
SignalP No significant hit
TMHMM No significant hit