close all open/close all

CDS information : Borre_00400


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction70,445 / 71,848 / + [in whole cluster]
70,445 / 71,848 / + [in contig]
Location70445..71848 [in whole cluster]
70445..71848 [in contig]
TypeCDS
Length1,404 bp (467 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative aldehyde dehydrogenase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number1.2.1.-
Keyword
Note
Note (GenBank)
  • ORFB19
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
Related Reference
ACC
P25526
PmId
[2254272] Molecular analysis of two genes of the Escherichia coli gab cluster: nucleotide sequence of the glutamate:succinic semialdehyde transaminase gene (gabT) and characterization of the succinic semialdehyde dehydrogenase gene (gabD). (J Bacteriol. , 1990)
[8297211] Molecular organization of the Escherichia coli gab cluster: nucleotide sequence of the structural genes gabD and gabP and expression of the GABA permease gene. (Arch Microbiol. , 1993)
[2178550] Stereospecific production of the herbicide phosphinothricin (glufosinate) by transamination: isolation and characterization of a phosphinothricin-specific transaminase from Escherichia coli. (Appl Environ Microbiol. , 1990)
[12446648] The Escherichia coli gabDTPC operon: specific gamma-aminobutyrate catabolism and nonspecific induction. (J Bacteriol. , 2002)
ACC
O33455
PmId
[9150211] p-Cymene catabolic pathway in Pseudomonas putida F1: cloning and characterization of DNA encoding conversion of p-cymene to p-cumate. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative aldehyde dehydrogenase [hypothetical protein]
MPTPAPDHAPAQRAAPLAVVDPATGTVFDEAPDQGPDVLDAVVDRARRAWHGWRADPDAR
TTALRSAADAVEAAGDDLARLLTREQGKPLAESHAEVARTAARLRYFAGLAPRTRRITDG
RPVRSEVRWRPLGPVAAIVPWNFPLQLASAKFAPALAAGNTMVLKPSPFTPLATRLLGSV
LATALPEDVLTVVTGREPLGARLAAHPGIRHVTFTGSVPTGRAVARAAAASLARVTLELG
GNDAAVLLDDVEVDRIADRLFWAAFRNCGQVCMAVKRVYAPARLHAQVVEALTERAKAVA
VGPGLDPRTRLGPVANAPQLARVEQITRRALADGARAAAGGHRLDGPGCFFAPTILTDVP
PDSPVVTEEQFGPVLPVLPYRSLDEAVDAANGTGFGLGGSVWGTDLDRAEAVADRLECGT
AWVNHHAELSLAQPFAGDKDSGVGVAGGPWGLYGNLRPFVVHRPRGE
selected fasta
>putative aldehyde dehydrogenase [hypothetical protein]
ATGCCGACCCCCGCACCCGACCACGCCCCCGCACAGCGGGCCGCGCCTCTCGCGGTCGTC
GATCCGGCCACCGGAACGGTCTTCGACGAGGCCCCCGACCAGGGACCGGACGTGCTGGAC
GCCGTCGTCGACCGGGCCCGCCGGGCCTGGCACGGCTGGCGCGCCGATCCCGACGCCCGT
ACCACCGCGCTGCGCTCGGCGGCCGACGCGGTCGAGGCCGCCGGGGACGACCTCGCCCGT
CTCCTCACCCGGGAACAGGGAAAGCCCCTGGCCGAATCGCATGCGGAGGTCGCCCGGACG
GCGGCCCGCCTGCGCTACTTCGCCGGCCTGGCCCCCCGGACCCGGCGCATCACCGACGGG
CGGCCGGTGCGCAGCGAGGTCCGCTGGCGCCCCCTCGGACCCGTCGCCGCGATCGTGCCG
TGGAACTTCCCCCTCCAACTCGCGTCGGCGAAGTTCGCGCCCGCGCTCGCCGCGGGCAAC
ACCATGGTCCTCAAACCCTCCCCCTTCACCCCGCTCGCCACCCGGCTGCTCGGGTCCGTC
CTCGCCACCGCCCTGCCCGAGGACGTCCTGACGGTCGTCACCGGCCGCGAGCCACTCGGC
GCCCGCCTCGCCGCACACCCCGGCATCCGCCACGTCACCTTCACCGGATCGGTGCCCACG
GGCCGGGCCGTCGCCCGAGCGGCGGCGGCCTCGCTCGCCCGGGTCACCCTGGAACTGGGC
GGCAACGACGCCGCGGTCCTGCTGGACGACGTCGAAGTGGACCGGATCGCCGACCGGCTG
TTCTGGGCCGCGTTCCGCAACTGCGGGCAGGTCTGCATGGCGGTCAAGCGCGTCTACGCA
CCGGCCCGTCTGCACGCACAGGTCGTCGAAGCCCTCACCGAGCGCGCCAAGGCCGTCGCC
GTCGGGCCCGGCCTCGACCCCCGCACCCGGCTGGGACCGGTCGCCAACGCCCCCCAGCTG
GCCCGGGTCGAGCAGATCACCCGGCGCGCCCTGGCGGACGGCGCCCGGGCGGCGGCCGGC
GGCCACCGGCTGGACGGGCCGGGCTGCTTCTTCGCCCCCACGATCCTCACCGACGTCCCG
CCCGACAGCCCGGTGGTGACCGAGGAGCAGTTCGGGCCGGTACTGCCGGTGCTGCCGTAC
CGGAGCCTGGACGAAGCCGTCGACGCGGCCAACGGCACGGGATTCGGGCTGGGGGGCTCC
GTATGGGGCACCGACCTCGACCGGGCCGAGGCGGTGGCCGACCGGCTGGAATGCGGCACG
GCCTGGGTCAACCACCACGCCGAGCTGTCCCTCGCCCAGCCCTTCGCCGGCGACAAGGAC
AGCGGGGTCGGCGTCGCGGGCGGGCCGTGGGGACTGTACGGCAACCTCCGTCCGTTCGTC
GTCCACCGACCGCGGGGGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR015590 Aldehyde dehydrogenase domain (Domain)
 [16-452]  PF00171
PF00171   Aldedh
IPR016160 Aldehyde dehydrogenase, conserved site (Conserved_site)
 [237-244]  PS00687
PS00687   ALDEHYDE_DEHYDR_GLU
 [265-276]  PS00070
PS00070   ALDEHYDE_DEHYDR_CYS
IPR016161 Aldehyde/histidinol dehydrogenase (Domain)
 [13-467]  SSF53720
SSF53720   Aldehyde_DH/Histidinol_DH
IPR016162 Aldehyde dehydrogenase, N-terminal (Domain)
 [16-251]  7.59999999999998e-76 G3DSA:3.40.605.10
G3DSA:3.40.605.10   Aldehyde_dehydrogenase_N
IPR016163 Aldehyde dehydrogenase, C-terminal (Domain)
 [252-435]  1.5e-64 G3DSA:3.40.309.10
G3DSA:3.40.309.10   Aldehyde_dehydrogenase_C
SignalP
 [1-25]  0.098 Signal
Eukaryota   
TMHMM No significant hit