close all open/close all

CDS information : Borre_00410


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction71,845 / 72,957 / + [in whole cluster]
71,845 / 72,957 / + [in contig]
Location71845..72957 [in whole cluster]
71845..72957 [in contig]
TypeCDS
Length1,113 bp (370 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative aryl-alcohol dehydrogenase
putative benzyl alcohol dehydrogenase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number1.1.1.90
Keyword
Note
Note (GenBank)
  • ORFB20
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
Related Reference
ACC
Q2Z1W5
PmId
[16292529] Characterization of four Rhodococcus alcohol dehydrogenase genes responsible for the oxidation of aromatic alcohols. (Appl Microbiol Biotechnol. , 2006)
ACC
P39849
PmId
[8496150] Kinetic studies on benzyl alcohol dehydrogenase encoded by TOL plasmid pWWO. A member of the zinc-containing long chain alcohol dehydrogenase family. (J Biol Chem. , 1993)

close this sectionSequence

selected fasta
>putative aryl-alcohol dehydrogenase [hypothetical protein]
MTVSFRAAVLRGYEDPFTVEEVTLGTEPGAGEILVEIAGCGMCRTDLAVRRSAGRSPLPA
VLGHEGSGVVVRTGGGPDTAIGVGDHVVLSFDSCGHCRNCRAAAPAYCDSFASLNLFGGR
AEDPPRLTDGSGAALAPRWFGQSAFAEYALVSARNAVRVDPALPVELLGPLGCGFLTGAG
AVLNTFAAGPGDTLVVLGAGAVGLAAVMAATAAGAPSVAVDRNPRRLELAERFGAVPLPA
ATAGLAERIRRLTDGGARYALDTTASVPLINEALRALRPTGALGLVARLHTALPLEPGTL
DRGRSIRHVCEGDAVPGLLIPQLTRLWQAGRFPFDQLVRTYPLADINEAERDCDAGLVVK
PVLLPPARSR
selected fasta
>putative aryl-alcohol dehydrogenase [hypothetical protein]
GTGACGGTGAGCTTCCGGGCGGCCGTACTGCGCGGGTACGAGGACCCCTTCACGGTCGAG
GAGGTGACCCTGGGGACGGAGCCCGGCGCAGGGGAGATCCTGGTCGAGATCGCCGGCTGC
GGAATGTGCCGGACCGATCTCGCGGTCCGGCGCTCGGCCGGCCGGAGCCCGCTGCCGGCG
GTGCTCGGCCACGAGGGCTCCGGGGTGGTGGTGCGGACGGGCGGCGGCCCGGACACCGCG
ATCGGCGTCGGTGACCACGTGGTGCTGAGCTTCGACTCCTGCGGGCACTGCCGCAACTGC
CGCGCGGCGGCCCCCGCCTACTGTGATTCCTTCGCCTCCCTCAACCTCTTCGGGGGCCGT
GCGGAGGACCCGCCGCGGCTCACCGACGGGTCGGGGGCGGCACTGGCTCCCCGGTGGTTC
GGACAGTCCGCCTTCGCCGAGTACGCGCTCGTCTCCGCCCGCAACGCCGTTCGGGTCGAC
CCCGCCCTGCCCGTCGAACTGCTCGGGCCGCTGGGCTGCGGCTTCCTCACCGGAGCCGGA
GCCGTGCTCAACACCTTCGCCGCCGGGCCGGGCGACACCCTCGTCGTGCTCGGCGCGGGC
GCCGTGGGCCTGGCCGCGGTGATGGCGGCCACCGCCGCCGGCGCACCGTCCGTGGCCGTG
GACCGCAACCCCCGTCGCCTGGAGCTGGCCGAGCGGTTCGGCGCGGTCCCGCTGCCCGCC
GCGACGGCCGGACTGGCCGAGCGGATCCGGCGGCTCACGGACGGCGGCGCGCGGTACGCA
CTGGACACGACCGCCTCCGTCCCACTGATCAACGAGGCGCTGCGCGCACTGCGTCCCACC
GGCGCTCTCGGCCTGGTGGCACGGCTCCACACCGCGCTGCCCCTGGAACCGGGCACGCTC
GACCGGGGGCGCAGCATCCGCCACGTCTGCGAGGGGGACGCGGTACCCGGTCTGCTGATA
CCGCAGCTGACCCGGCTCTGGCAGGCCGGACGCTTCCCCTTCGACCAGCTCGTCCGTACC
TACCCGCTGGCCGACATCAACGAGGCGGAGCGCGACTGCGACGCCGGCCTCGTGGTCAAA
CCCGTGCTGCTCCCGCCCGCGAGGAGCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011032 GroES-like (Domain)
 [5-198]  4.79998722798115e-54 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [201-287]  1.2e-15 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [31-158]  1.99999999999999e-19 PF08240
PF08240   ADH_N
IPR016040 NAD(P)-binding domain (Domain)
 [194-298]  2.90000000000001e-26 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit