close all open/close all

CDS information : Borre_00420


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction73,037 / 73,942 / + [in whole cluster]
73,037 / 73,942 / + [in contig]
Location73037..73942 [in whole cluster]
73037..73942 [in contig]
TypeCDS
Length906 bp (301 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative methyltransferase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • ORFB21
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
Family/Domain
FD
IPR011610, IPR007213

close this sectionSequence

selected fasta
>putative methyltransferase [hypothetical protein]
MTGTAPQYTDVEGVNGGVGLTAFLVAAARAIETHRDDSLAQDVYAEHFVRAAPACADWPV
RIEQVPDGDGNPLWGRFARYFGLRTRALDDFLLRSVRTGPRQVVLLGAGLDTRAFRLDWP
SQCAVFEIDRTGVLAFKQQVLTDLAATPRVERVPVPVDLRADWAGALTAAGFDPAAPSVW
LAEGLLFYLPGPAESLLVDTVDRLTTDGSALAFEAKLEKDLLAYRDSAIYTATREQIGID
LLRLFDKGPRPDSAGELAARGWSTSMHTPFVFTHRYGRGPLPEPNDALEGNRWVFARKPG
P
selected fasta
>putative methyltransferase [hypothetical protein]
ATGACCGGCACGGCGCCGCAGTACACGGACGTGGAAGGCGTGAACGGAGGTGTGGGCCTG
ACGGCCTTCCTGGTCGCCGCCGCGCGGGCGATCGAGACCCATCGCGACGACAGTCTGGCC
CAGGACGTCTACGCGGAACACTTCGTGCGCGCCGCCCCGGCGTGCGCGGACTGGCCGGTG
CGCATCGAGCAGGTCCCCGACGGGGACGGCAACCCGCTGTGGGGACGGTTCGCCCGCTAT
TTCGGCCTGCGGACCCGGGCCCTCGACGACTTCCTGCTCCGGTCGGTCCGGACGGGCCCC
CGACAGGTGGTGCTGCTGGGCGCGGGGTTGGACACCCGTGCCTTCCGGCTCGACTGGCCG
TCGCAGTGCGCGGTCTTCGAGATCGACCGGACGGGCGTGCTCGCCTTCAAACAGCAGGTG
CTCACGGACCTGGCGGCAACCCCGAGAGTGGAGCGCGTCCCCGTTCCGGTCGATCTGCGC
GCGGACTGGGCCGGCGCGCTGACCGCGGCCGGCTTCGACCCCGCGGCGCCCAGCGTCTGG
CTGGCCGAGGGACTGCTCTTCTATCTGCCGGGCCCCGCCGAGTCGCTTCTCGTCGACACG
GTGGACCGGCTGACCACCGACGGCAGCGCGCTGGCCTTCGAGGCCAAGCTGGAGAAGGAC
CTGCTGGCGTACCGCGACAGTGCGATCTACACGGCGACGCGCGAGCAGATCGGCATCGAC
CTCCTCCGCCTCTTCGACAAGGGGCCCCGACCCGACTCCGCGGGTGAGCTGGCGGCCAGA
GGCTGGTCCACCTCGATGCACACGCCCTTCGTCTTCACCCACCGGTACGGACGCGGTCCC
CTCCCCGAGCCGAACGACGCGCTGGAGGGGAACCGATGGGTCTTCGCCCGCAAGCCCGGG
CCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007213 Leucine carboxyl methyltransferase (Family)
 [22-201]  8.70000000000003e-49 PF04072
PF04072   LCM
IPR011610 S-adenosyl-L-methionine-dependent methyltransferase, putative (Family)
 [20-278]  9.10000000000013e-75 TIGR00027
TIGR00027   Mthyl_TIGR00027
SignalP
 [1-30]  0.305 Signal
Bacteria, Gram-positive   
 [1-30]  0.405 Signal
Bacteria, Gram-negative   
 [1-30]  0.227 Signal
Eukaryota   
TMHMM No significant hit