close all open/close all
Borre_00420 Borre_00420   last last

CDS information : Borre_00430


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction74,537 / 73,995 / - [in whole cluster]
74,537 / 73,995 / - [in contig]
Locationcomplement(73995..74537) [in whole cluster]
complement(73995..74537) [in contig]
TypeCDS
Length543 bp (180 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORFB22
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MMCMRDEAAKRVELVFSLFDANGNGVIDSDDFDLMTDRVVAAAAGSDDSAKAAVRAAFRR
YWTTLATELDADGDGVITVEEFRPFVLDPERFGPTIAEFARALSALGDPDGDGLIERPLF
VALMKAIGFEEANIHALFDAFAPDAADRITVAAWASGIEDYYAPDLAGIPGDRLVAARTV
selected fasta
>hypothetical protein [hypothetical protein]
GTGATGTGCATGCGAGATGAGGCCGCCAAGCGGGTCGAGCTGGTCTTCTCCCTCTTCGAC
GCCAACGGCAACGGAGTCATCGACTCCGACGACTTCGACCTGATGACCGACCGGGTCGTT
GCGGCGGCGGCCGGGTCGGACGACAGCGCCAAGGCCGCCGTCCGGGCCGCGTTCCGCCGC
TACTGGACCACGCTGGCCACCGAACTGGACGCCGACGGCGACGGCGTGATCACCGTGGAG
GAGTTCCGTCCGTTCGTACTCGATCCCGAGCGCTTCGGTCCCACCATCGCCGAGTTCGCT
CGGGCACTGTCCGCGCTCGGCGATCCCGACGGGGACGGGCTGATCGAGCGTCCCCTCTTC
GTCGCGCTGATGAAGGCGATCGGTTTCGAGGAAGCGAACATCCACGCGCTGTTCGACGCC
TTCGCCCCGGACGCCGCGGACCGCATCACCGTGGCCGCGTGGGCCTCCGGCATCGAGGAC
TACTACGCGCCGGACCTGGCCGGGATCCCGGGCGACCGGCTGGTGGCCGCCCGGACCGTC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002048 Calcium-binding EF-hand (Repeat)
 [11-39]  0.00329999983317491 SM00054 [61-89]  0.0739999967908914 SM00054 [98-127]  0.0969999929644903 SM00054
SM00054   EFh
IPR011992 EF-hand-like domain (Domain)
 [5-78]  3.8e-14 G3DSA:1.10.238.10 [79-126]  2.1e-18 G3DSA:1.10.238.10
G3DSA:1.10.238.10   EF-Hand_type
IPR018247 EF-Hand 1, calcium-binding site (Binding_site)
 [20-32]  PS00018 [70-82]  PS00018
PS00018   EF_HAND_1
IPR018249 EF-HAND 2 (Repeat)
 [7-42]  PS50222 [68-92]  PS50222 [108-130]  PS50222
PS50222   EF_HAND_2
SignalP No significant hit
TMHMM No significant hit
Borre_00420 Borre_00420   last last