close all open/close all
first first   C1027_00020 C1027_00020

CDS information : C1027_00010


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction658 / 8 / - [in whole cluster]
658 / 8 / - [in contig]
Locationcomplement(8..658) [in whole cluster]
complement(8..658) [in contig]
TypeCDS
Length651 bp (216 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hydroxylase-like protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in C-1027 biosynthesis.
Note (GenBank)
  • ORF(-7)
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [hydroxylase-like protein]
MGMTGARPRVLVVGAGLAGTATAIRLLHFARRPLEVVLLERRAAYRSAGVAYHRDGNPWD
HVFNIQAGRMSVFREDVLDFINWANQEADRRDWPRRWASWKFTEQGPAPRRIFQDYLDAR
LVEAARESCPGVVLVEADGEALDARSHDRCFEVTVRGLTPYLTEGLRPGPLPDTQILDAD
HVVLATGLELKEPPFAAGVAGHPSFVRNPYSAPGIL
selected fasta
>hypothetical protein [hydroxylase-like protein]
ATGGGCATGACGGGTGCGCGCCCCAGGGTGCTGGTCGTAGGGGCGGGCCTGGCAGGCACG
GCGACCGCGATACGCCTGCTTCATTTCGCGAGAAGACCGCTGGAAGTCGTCCTCCTGGAG
CGGCGCGCCGCCTACCGCTCGGCCGGCGTCGCCTATCACCGTGACGGCAACCCCTGGGAC
CACGTCTTCAATATCCAGGCCGGCAGGATGTCGGTGTTCCGCGAGGACGTGCTCGACTTC
ATCAACTGGGCCAACCAGGAGGCCGACCGGCGCGACTGGCCCCGGCGCTGGGCTTCGTGG
AAGTTCACCGAACAGGGCCCCGCCCCCCGCCGCATCTTCCAGGACTACCTCGACGCCCGA
CTGGTCGAGGCCGCACGGGAGTCCTGTCCCGGCGTCGTCCTTGTGGAAGCGGACGGGGAG
GCGCTCGACGCCCGGTCCCACGACCGCTGCTTCGAGGTGACCGTCAGGGGCCTCACCCCG
TACCTGACCGAGGGGCTGCGCCCTGGGCCGCTCCCCGACACGCAGATCCTCGACGCGGAC
CACGTCGTCCTCGCCACCGGCCTCGAACTCAAGGAACCGCCCTTCGCCGCAGGCGTCGCC
GGGCACCCCTCCTTCGTCCGTAACCCCTACTCCGCACCCGGGATCCTCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit
first first   C1027_00020 C1027_00020