close all open/close all

CDS information : C1027_00020


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction1,478 / 930 / - [in whole cluster]
1,478 / 930 / - [in contig]
Locationcomplement(930..1478) [in whole cluster]
complement(930..1478) [in contig]
TypeCDS
Length549 bp (182 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)viral infectivity potentiator-like protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in C-1027 biosynthesis.
Note (GenBank)
  • ORF(-6)
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [viral infectivity potentiator-like protein]
MPRIPVHTIDTAPAAGGDILRRLEKRFGRVLNIHGGMAHSPVVLETYAAITGAVAEHGTF
DARTREAIALAVGAVDACAYCQAAHTVSAKVAGFTLEETVAIRRGTPGDDVKLEALVQVA
REIAGEVGEASDASWNAAVAQGWTDTELAEVFVHVAVNLYTNYFNHYARTEIDVPGVPDI
DS
selected fasta
>hypothetical protein [viral infectivity potentiator-like protein]
ATGCCGCGGATTCCCGTCCACACCATCGACACCGCACCCGCAGCCGGCGGAGACATCCTG
CGCCGACTGGAGAAGCGGTTCGGGCGAGTGCTCAACATCCACGGGGGAATGGCCCATTCC
CCCGTGGTCCTGGAAACCTACGCCGCGATCACCGGAGCCGTCGCCGAACATGGAACGTTC
GACGCCCGCACACGCGAGGCGATCGCCCTCGCCGTGGGCGCGGTCGACGCGTGCGCGTAC
TGCCAGGCGGCGCACACGGTGTCGGCGAAGGTCGCGGGTTTCACGCTGGAGGAGACCGTG
GCGATTCGCCGGGGGACGCCCGGCGACGACGTGAAGCTCGAAGCACTGGTCCAGGTGGCC
AGGGAGATCGCCGGCGAAGTGGGCGAGGCGTCTGACGCCTCGTGGAACGCGGCCGTGGCA
CAGGGATGGACGGACACCGAGCTCGCCGAGGTCTTCGTCCACGTGGCCGTGAACCTCTAC
ACCAACTACTTCAACCACTACGCCCGCACCGAGATCGACGTCCCTGGCGTTCCCGACATC
GACAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003779 Carboxymuconolactone decarboxylase (Domain)
 [41-113]  1.2e-12 PF02627
PF02627   CMD
IPR004675 Alkylhydroperoxidase AhpD core (Domain)
 [61-100]  5.3e-08 TIGR00778
TIGR00778   AhpD_dom
SignalP No significant hit
TMHMM No significant hit