close all open/close all

CDS information : C1027_00030


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction2,713 / 1,649 / - [in whole cluster]
2,713 / 1,649 / - [in contig]
Locationcomplement(1649..2713) [in whole cluster]
complement(1649..2713) [in contig]
TypeCDS
Length1,065 bp (354 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)truncated methionine synthase-like protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in C-1027 biosynthesis.
Note (GenBank)
  • Orf(-5)
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [truncated methionine synthase-like protein]
MTIATEPIGSLPRSATLLHALAAHAQGTLDATDLAKQQEQAVADTLTRLERVGSPVLVDG
EQSKPSFATYPVTGLDTLSPDGAVIPFADGHTRQLPSITQGPFRYQVRAETYLRAARQLT
DRPLKQAVIAPSALSLLYPATPIEGYPREQFLRDLADEAEADIRGCLDAGAHVVQLDFTE
GRLSLKLDPSGGVLDDFIALNNEVLGRFSAEETARIGVHTCPGGDQDSTHSLDIDYAELL
PKLFQLKAGNFYLELAGEADPERVLSIVRDHLPPAARVFLGVTDPIDPVVETPEQVRDRI
LLAARYIPVEQLGTCDDCGFSPFADDTSTTRDLAFAKIEARVRGTALAEEVLGL
selected fasta
>hypothetical protein [truncated methionine synthase-like protein]
ATGACCATCGCCACTGAGCCGATCGGCAGCCTTCCGCGCTCCGCGACACTCCTGCACGCC
CTTGCCGCGCATGCCCAGGGAACCCTGGACGCCACGGACCTGGCCAAACAGCAGGAACAG
GCCGTCGCGGACACCCTGACACGACTGGAACGAGTCGGCAGCCCCGTCCTCGTGGACGGT
GAACAGTCCAAGCCGAGCTTCGCCACCTACCCCGTGACCGGCCTCGACACCCTCTCGCCC
GACGGCGCTGTCATCCCCTTCGCAGACGGGCACACCCGGCAGCTCCCCAGCATCACCCAA
GGGCCCTTCCGCTACCAGGTGCGGGCCGAAACCTATCTGCGCGCCGCACGGCAGCTCACG
GACCGCCCCCTGAAGCAGGCGGTCATCGCACCCTCCGCCCTCAGCCTCCTCTACCCCGCC
ACTCCCATCGAGGGCTACCCCCGCGAGCAGTTCCTGCGCGACCTCGCCGACGAGGCCGAA
GCCGACATCCGAGGCTGCCTGGACGCGGGGGCACACGTGGTCCAGCTCGACTTCACCGAG
GGGCGGCTGTCCCTCAAGCTCGACCCCAGCGGCGGCGTCCTCGACGACTTCATCGCCCTC
AACAACGAAGTCCTGGGGCGCTTCAGCGCCGAGGAAACCGCCCGCATCGGCGTACACACC
TGCCCCGGCGGCGACCAGGACTCCACGCACAGCCTCGACATCGACTACGCCGAACTGCTG
CCCAAGCTCTTCCAGCTCAAGGCGGGCAACTTCTATCTCGAACTGGCCGGCGAAGCGGAC
CCCGAGCGGGTCCTGAGCATCGTCCGTGACCACCTGCCCCCTGCCGCCCGCGTCTTCCTC
GGGGTGACCGACCCGATCGACCCAGTGGTCGAGACCCCCGAGCAGGTACGCGACCGCATC
CTGCTCGCCGCCCGCTACATCCCCGTCGAGCAACTGGGAACCTGCGACGACTGCGGCTTC
TCCCCGTTCGCCGACGACACCTCCACCACACGCGACCTGGCCTTCGCCAAGATCGAGGCC
CGTGTTCGGGGCACCGCCCTGGCCGAGGAGGTGCTCGGCCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002629 Methionine synthase, vitamin-B12 independent (Domain)
 [4-321]  1.3e-13 PF01717
PF01717   Meth_synt_2
SignalP No significant hit
TMHMM No significant hit