close all open/close all

CDS information : C1027_00050


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction4,971 / 3,442 / - [in whole cluster]
4,971 / 3,442 / - [in contig]
Locationcomplement(3442..4971) [in whole cluster]
complement(3442..4971) [in contig]
TypeCDS
Length1,530 bp (509 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative primase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in C-1027 biosynthesis.
Note (GenBank)
  • ORF(-3); similar to SCP1
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [putative primase]
MSSSAEGPRFDATAAAQQMLALETTPAPAPLLPVQAAPEAPVAATAWEAGEIPASLTDRG
NAKLFVRLYRDQFRHVEGLGWYSWDGYRWKRAGGEKAALWAAGEMAEEMPGSDPRGLFTD
RELHHHKRRTLSTTGMKALLTQAKASPDLSLDPDTLDGDPYALCTPDGVVDLRNGRMRKP
DPTRDFHSRATSASPQDIPTPRWHRFLEDTFGSDAEGREMIDFLHLLLGYSITGDVGAQV
LPFLHGQGKNGKSVLLDVMIQILGDYADAAPPGFLMDRGAYSEHSTELTELHGRRLIVCS
ELKPNDRFDEARVRLLTGGDKIKARRMRQDYFSFTPTHKLWLLGNHRPEVSTGGFAFWRR
IRLLPFERIVPDERKIDNLAVELVQDEGPGILHWLTEGARRYLATRDTLAGPDRVRIATS
AYANTEDHIGRFLAECCLHDPENSELRVEQGLLYTSYSTWCAHSEGIRPGTARAFATRVR
QEVGLASPADMIKSNGRKFYPNLALAADE
selected fasta
>hypothetical protein [putative primase]
ATGAGCAGCAGCGCCGAGGGCCCTCGCTTTGACGCAACTGCCGCCGCTCAGCAGATGCTG
GCCCTCGAAACCACCCCGGCCCCAGCGCCGCTCCTCCCTGTCCAGGCCGCTCCCGAGGCC
CCCGTCGCCGCGACCGCCTGGGAGGCGGGCGAGATTCCCGCCAGCCTGACCGACCGCGGC
AACGCCAAGCTCTTCGTCCGTCTCTACCGTGACCAGTTCCGGCACGTGGAGGGCCTGGGC
TGGTACTCCTGGGACGGCTACCGGTGGAAGCGGGCCGGAGGCGAGAAAGCTGCCCTGTGG
GCTGCCGGAGAGATGGCGGAGGAGATGCCCGGCAGCGATCCCCGCGGGCTGTTCACCGAC
CGGGAACTGCACCACCACAAACGCCGCACCCTGTCGACGACCGGTATGAAGGCGCTCCTC
ACCCAGGCAAAGGCCTCTCCCGACCTCTCCCTCGATCCCGACACCCTCGACGGAGACCCC
TACGCCCTGTGCACCCCTGACGGAGTGGTCGACCTCCGCAACGGCCGTATGCGCAAGCCC
GACCCCACCCGGGACTTCCACTCCCGCGCCACCAGCGCCTCCCCCCAGGACATCCCCACC
CCCCGCTGGCACCGTTTCCTCGAAGACACCTTCGGCAGTGACGCCGAAGGGCGGGAGATG
ATCGACTTCCTCCACCTCCTTCTCGGCTACTCCATCACCGGTGACGTCGGGGCGCAGGTG
CTGCCCTTTCTCCACGGCCAGGGAAAGAACGGCAAATCCGTTCTCCTCGACGTGATGATC
CAGATTCTCGGCGACTACGCCGACGCAGCCCCGCCGGGTTTCCTCATGGACCGTGGCGCA
TACTCCGAACACTCCACCGAGCTCACCGAACTCCACGGCCGCCGCCTCATCGTGTGCAGC
GAGCTCAAGCCCAACGACCGCTTCGACGAGGCGCGCGTCCGCCTGCTGACCGGCGGTGAC
AAGATCAAGGCCCGCCGCATGCGGCAGGACTATTTCTCCTTCACACCCACGCACAAGCTG
TGGCTGCTGGGCAACCACCGCCCCGAGGTCTCCACCGGCGGCTTCGCCTTCTGGCGCCGC
ATCCGCCTCCTGCCCTTCGAACGGATCGTCCCCGACGAACGCAAGATCGACAACCTGGCT
GTCGAACTCGTCCAGGACGAGGGCCCCGGGATCCTGCACTGGCTCACCGAAGGGGCCCGC
CGCTACCTCGCCACCCGCGACACACTCGCCGGCCCCGACCGGGTCCGCATCGCCACCAGC
GCATACGCGAACACCGAGGACCACATCGGCCGCTTCCTCGCCGAGTGCTGCCTCCACGAC
CCCGAGAACAGCGAGCTACGCGTCGAACAGGGCCTTCTCTACACGTCCTACAGCACCTGG
TGCGCACACAGTGAAGGCATCCGCCCCGGGACCGCCCGTGCCTTCGCCACCCGGGTCCGC
CAGGAAGTGGGCCTCGCCTCACCTGCCGACATGATCAAATCCAACGGCCGGAAGTTCTAC
CCCAACCTCGCTCTGGCAGCCGACGAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006500 DNA primase, phage/plasmid (Domain)
 [161-465]  3.60000000000002e-78 TIGR01613
TIGR01613   Primase_Cterm
IPR014015 Helicase, superfamily 3, DNA virus (Domain)
 [219-379]  PS51206
PS51206   SF3_HELICASE_1
IPR014818 Bacteriophage/plasmid primase, P4, C-terminal (Domain)
 [62-212]  1.89999859865865e-19 SM00885
SM00885   D5_N
 [62-211]  9.10000000000001e-29 PF08706
PF08706   D5_N
SignalP No significant hit
TMHMM No significant hit