close all open/close all

CDS information : C1027_00070


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction9,927 / 7,573 / - [in whole cluster]
9,927 / 7,573 / - [in contig]
Locationcomplement(7573..9927) [in whole cluster]
complement(7573..9927) [in contig]
TypeCDS
Length2,355 bp (784 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productputative UvrA-like protein
Product (GenBank)UvrA-like drug resistance pump
GenesgcB2
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF(-1)
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
Q54827
NITE
Adria_00370
PmId
[8655504] The Streptomyces peucetius drrC gene encodes a UvrA-like protein involved in daunorubicin resistance and production. (J Bacteriol. , 1996)
[9835035] The DrrC protein of Streptomyces peucetius, a UvrA-like protein, is a DNA-binding protein whose gene is induced by daunorubicin. (FEMS Microbiol Lett. , 1998)

close this sectionSequence

selected fasta
>putative UvrA-like protein [UvrA-like drug resistance pump]
MYGSQEENSVSVTDPTAGAGKTSGPGDGIRIAGARIHNLKDVSLTIPRNQITVFTGVSGS
GKSSIVFDTVAVEAQRQLNSTFSWYIRNQLPKYERPQAEAIENLTTPVIVDQKPVGGNAR
STVGTMTDVQPMIRALFARFGTTKDDGPSSLGVSAFSFNDPQGMCPDCDGLGQSIALDLD
KMLDRSKSLDDGAVLFPEYKVGSPDWQIWAKSGRLDPAKPIAEYSAEELDTLLRGTGGKV
TLKTKSTEFQTNYEGLADRFERLNLKRDLSALSDRKREVIERFVTDGVCPSCRGARLNAA
ALDVRIDGKNIADYSSMEVRDLTEVLAGVTEPAAAPLAKAARTALERIVSIGLGYLTLDR
PTADLSGGEGQRLKMVRHLGSGLAGLTYIFDEPSIGLHPRDVGRLNDLLRALRDKGNTVL
VVEHDPDVIEIADHIVDVGPGAGVHGGEIVFEGSFAKLRKAKTRTGEALRRGARVKEEVR
PPTGELTVENADLHNLKQVSVAVPTGVLTAVTGVAGSGKSSLISGAFMEAHPDAVFVDQS
AIAASSRSTPVSYLGLMDPLRKLFAKETGANASLFSFNSKGSCEECQGRGVIITELAFMD
PVTTHCGVCEGRRFKPEVLEHQLRGKSIADVLELPADEAVEFFTEKALLPKLRALVDVGL
GYLSLGQPLSSLSGGELQRIKLADQLHRTGTVYVLDEPTTGLHMSDVDTLLKLLDGLVEA
GNTVVVIEHNLDVVQQADWIIDLGPDGGREGGEIVFTGTPKDLLAADSSLTGEYLRRHLK
AQAG
selected fasta
>putative UvrA-like protein [UvrA-like drug resistance pump]
ATGTACGGAAGCCAGGAGGAAAACTCTGTGAGCGTCACCGACCCCACCGCCGGCGCGGGA
AAAACATCCGGCCCGGGAGACGGCATCCGCATCGCGGGCGCGCGGATCCACAACCTCAAA
GATGTCTCCCTGACGATTCCCCGCAACCAGATCACGGTCTTCACGGGGGTCTCGGGTTCG
GGCAAGTCGTCGATCGTCTTCGACACGGTGGCCGTGGAGGCCCAGCGACAGCTGAACTCC
ACCTTCAGCTGGTACATCCGCAACCAGCTTCCGAAGTACGAACGTCCTCAGGCCGAGGCG
ATCGAGAACCTCACCACCCCGGTGATCGTCGACCAGAAGCCCGTGGGGGGCAACGCCCGG
TCCACGGTGGGGACCATGACGGACGTACAGCCGATGATCCGGGCCCTGTTCGCACGGTTC
GGCACGACGAAGGACGACGGGCCGTCCTCGCTCGGCGTCTCCGCGTTCTCGTTCAACGAC
CCCCAGGGCATGTGCCCGGACTGCGACGGTCTCGGCCAGAGCATCGCCCTCGACCTGGAC
AAGATGCTGGACCGCTCGAAGTCCCTGGACGACGGGGCGGTCCTTTTCCCCGAGTACAAG
GTGGGTAGCCCGGACTGGCAGATCTGGGCGAAGTCCGGCCGTCTGGATCCGGCCAAGCCG
ATCGCCGAGTACAGCGCCGAGGAGCTGGACACGCTGCTGCGCGGCACCGGCGGGAAGGTG
ACGCTGAAGACCAAGAGCACCGAGTTCCAGACGAACTACGAGGGGTTGGCCGACCGGTTC
GAGCGGCTCAACCTCAAGCGCGACCTCAGCGCGCTGAGCGACCGCAAGCGCGAGGTCATC
GAACGTTTCGTCACCGACGGAGTCTGTCCCTCCTGCCGGGGCGCGCGGCTCAACGCCGCC
GCGCTCGACGTCCGGATCGACGGCAAGAACATCGCCGACTACTCGAGCATGGAGGTCCGC
GACCTCACGGAGGTGCTCGCCGGCGTCACGGAGCCGGCCGCTGCCCCTCTCGCGAAAGCC
GCGCGCACGGCCCTGGAGCGGATCGTGTCCATCGGGCTCGGCTACCTGACCCTGGACAGG
CCCACGGCCGACCTCTCGGGGGGCGAGGGGCAGCGGCTGAAGATGGTGCGCCACCTCGGC
AGTGGTCTGGCCGGGCTCACGTACATCTTCGACGAGCCCAGCATCGGCCTGCACCCGCGC
GACGTGGGGCGGCTCAACGACCTGCTGCGCGCGCTGCGCGACAAGGGGAACACCGTGCTG
GTCGTCGAGCACGACCCCGATGTGATCGAGATCGCCGACCACATCGTCGATGTCGGTCCC
GGGGCGGGAGTGCACGGGGGCGAGATCGTGTTCGAGGGGTCCTTCGCGAAGCTGCGGAAG
GCGAAGACCCGGACCGGGGAGGCTCTGCGGCGGGGGGCCCGCGTGAAGGAGGAGGTCCGC
CCGCCCACGGGGGAGCTGACCGTGGAGAACGCGGATCTCCACAACCTGAAGCAGGTCTCC
GTGGCCGTGCCCACCGGTGTGCTGACCGCGGTGACCGGGGTGGCGGGTTCCGGCAAGAGC
AGCCTGATCTCCGGGGCATTCATGGAGGCGCACCCCGACGCGGTCTTTGTCGACCAGTCC
GCGATCGCCGCCTCGTCGCGCTCCACACCGGTCTCCTACCTCGGCCTGATGGACCCGCTG
CGCAAGCTGTTCGCGAAGGAGACCGGCGCGAACGCCTCGCTGTTCAGCTTCAACTCCAAG
GGGTCGTGCGAGGAGTGCCAGGGCCGCGGGGTCATCATCACCGAGCTGGCCTTCATGGAT
CCGGTGACCACGCACTGCGGTGTCTGTGAGGGGCGCCGCTTCAAGCCCGAGGTCCTGGAG
CACCAGCTTCGCGGGAAGTCGATCGCGGACGTCCTGGAGCTGCCCGCCGACGAGGCCGTC
GAGTTCTTCACCGAGAAGGCCCTGCTGCCGAAACTGCGCGCTCTCGTCGACGTCGGTCTT
GGGTACCTCAGCCTGGGCCAGCCGCTTTCCAGCCTCTCCGGCGGTGAACTGCAGCGGATC
AAACTTGCCGACCAGCTGCACCGCACGGGCACGGTCTATGTCCTGGACGAGCCCACCACC
GGGCTGCACATGTCGGACGTTGACACCCTGCTGAAGCTCCTGGACGGGCTCGTCGAGGCC
GGGAACACCGTCGTGGTCATCGAGCACAACCTCGATGTGGTGCAGCAGGCCGACTGGATC
ATCGACCTGGGTCCCGACGGGGGACGGGAGGGCGGCGAGATCGTCTTCACCGGCACACCG
AAGGACCTGCTCGCCGCGGATTCCTCCCTGACCGGTGAGTATCTGCGCCGCCACCTGAAG
GCGCAGGCGGGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [10-465]  PS50893 [473-770]  PS50893
PS50893   ABC_TRANSPORTER_2
 [652-700]  6.50000000000001e-09 PF00005
PF00005   ABC_tran
IPR017871 ABC transporter, conserved site (Conserved_site)
 [672-686]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP No significant hit
TMHMM No significant hit