close all open/close all

CDS information : C1027_00080


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction11,349 / 9,982 / - [in whole cluster]
11,349 / 9,982 / - [in contig]
Locationcomplement(9982..11349) [in whole cluster]
complement(9982..11349) [in contig]
TypeCDS
Length1,368 bp (455 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative transporter
Product (GenBank)Na/H efflux pump
GenesgcB3
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF0
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
Q9SUQ7
PmId
[15341627] Characterization of AtCHX17, a member of the cation/H+ exchangers, CHX family, from Arabidopsis thaliana suggests a role in K+ homeostasis. (Plant J. , 2004)
[17133624] Arabidopsis thaliana CHX17 gene complements the kha1 deletion phenotypes in Saccharomyces cerevisiae. (Yeast. , 2006)
ACC
P40309
PmId
[9811642] A Saccharomyces cerevisiae mutant lacking a K+/H+ exchanger. (J Bacteriol. , 1998)
[15659172] Physiological characterization of Saccharomyces cerevisiae kha1 deletion mutants. (Mol Microbiol. , 2005)
Family/Domain
FD
IPR006153

close this sectionSequence

selected fasta
>putative transporter [Na/H efflux pump]
MAVLAATSPLGGEPLTVFLLQVGLLLACAYGLGRLGTRIGLPPLVGELTAGVLLGPTLLG
QISPGLSGRLFPEDISQAHLLDAFCQFGVLLLVAIAGAQFDPRILRKRGGLAARVSLAGL
LIPLGLGIATGYLVPASLLADSGERGVFALFLGVAMCVTALPVIAKTLADLNLTHRNVGQ
LLIAAAVFDDAVGWLLLALVTALASGAAGGPVVLTTMAWTTVFVAAACAVGGPIGRRLSR
TGDSRVPVSAVTVGVAVVVLYGALTAAAGMEALFGAFVAGATLLRHIAPVRLAPLRTLVM
AVFAPVFLGSVGLRMDLTALAEPSVLLTGLGVLLVATFGKFAGAYVAARSGGMSRYEGLA
LGAGMNSRGMIEVVIALVGLRIGVLDTVTFTIIVLVALITSVTAPPILRWASSRIVLEED
ETERGDRLAGWNTEPALSGGPAPKSAREEKTPDTS
selected fasta
>putative transporter [Na/H efflux pump]
GTGGCTGTGCTCGCAGCCACGTCGCCGCTGGGCGGGGAGCCGCTGACGGTCTTCCTGCTC
CAGGTCGGCCTCCTGCTCGCCTGTGCCTACGGTCTGGGACGGCTGGGGACCCGGATCGGT
CTGCCGCCGCTGGTGGGGGAGCTGACCGCGGGGGTACTGCTCGGGCCGACCCTGCTGGGG
CAGATCTCGCCGGGACTTTCCGGCAGGCTGTTTCCCGAGGACATCTCGCAGGCGCACCTG
CTCGACGCGTTCTGCCAGTTCGGCGTCCTTCTGCTGGTGGCCATCGCAGGTGCCCAGTTC
GACCCCCGGATCCTGCGCAAGCGCGGGGGTCTGGCCGCCCGGGTCAGCCTGGCGGGTCTT
CTGATTCCTCTGGGGCTGGGCATCGCCACCGGCTACCTGGTGCCCGCCTCGCTGCTCGCG
GACTCCGGAGAGCGGGGCGTCTTCGCGCTGTTCCTCGGGGTCGCGATGTGTGTCACGGCC
CTCCCGGTGATCGCCAAGACGCTCGCCGACCTGAATCTGACGCACCGCAACGTCGGCCAG
CTGCTCATCGCGGCAGCGGTGTTCGACGACGCGGTGGGCTGGCTGCTGCTCGCTCTGGTG
ACGGCGCTGGCGAGTGGGGCGGCCGGGGGGCCCGTGGTCCTGACCACGATGGCCTGGACG
ACCGTCTTCGTCGCCGCGGCGTGTGCGGTGGGCGGCCCGATCGGCAGGCGGCTGTCCCGT
ACGGGTGACAGCCGGGTCCCCGTATCGGCCGTCACCGTCGGCGTGGCCGTGGTCGTCCTG
TACGGGGCGCTGACCGCGGCGGCCGGGATGGAGGCGTTGTTCGGGGCGTTCGTGGCCGGT
GCGACCCTGCTGAGGCACATCGCCCCGGTACGGCTCGCCCCGCTGCGCACGCTGGTCATG
GCCGTGTTCGCACCGGTGTTCCTGGGCAGTGTGGGGCTTCGCATGGACCTGACCGCACTC
GCGGAGCCGTCGGTGCTGCTCACGGGCCTCGGGGTGCTGTTGGTGGCCACTTTCGGCAAG
TTCGCCGGTGCGTACGTCGCCGCCCGTAGTGGCGGGATGAGCCGCTACGAGGGGCTGGCG
CTCGGAGCGGGGATGAACTCGCGTGGAATGATCGAGGTGGTGATCGCCCTGGTCGGCCTG
CGTATCGGCGTACTGGACACCGTGACCTTCACGATCATCGTGCTGGTCGCCCTCATCACC
TCGGTGACGGCGCCGCCGATCCTGCGCTGGGCGAGCAGCCGGATCGTTCTCGAGGAGGAC
GAGACGGAGCGGGGGGATCGGCTGGCGGGGTGGAACACGGAGCCGGCCCTGTCCGGCGGG
CCGGCCCCCAAGTCAGCACGGGAGGAGAAGACCCCGGACACCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006153 Cation/H+ exchanger (Domain)
 [23-409]  6.29999999999997e-51 PF00999
PF00999   Na_H_Exchanger
SignalP No significant hit
TMHMM
 [10-32]  Transmembrane (o-i) [39-60]  Transmembrane (i-o) [75-97]  Transmembrane (o-i) [110-132]  Transmembrane (i-o) [147-169]  Transmembrane (o-i) [181-203]  Transmembrane (i-o) [213-235]  Transmembrane (o-i) [248-270]  Transmembrane (i-o) [290-312]  Transmembrane (o-i) [325-347]  Transmembrane (i-o) [377-399]  Transmembrane (o-i)
Transmembrane 11