close all open/close all

CDS information : C1027_00090


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction12,835 / 11,351 / - [in whole cluster]
12,835 / 11,351 / - [in contig]
Locationcomplement(11351..12835) [in whole cluster]
complement(11351..12835) [in contig]
TypeCDS
Length1,485 bp (494 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
ProductFADH2-dependent (S)-beta-tyrosyl-PCP halogenase
Product (GenBank)alkylhalidase
GenesgcC3
Gene (GenBank)
EC number
Keyword
  • two-component system
  • (S)-3-chloro-4,5-dihydroxy-beta-phenylalanine
Note
Note (GenBank)
  • ORF11
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[16104723] Biosynthesis of the beta-amino acid moiety of the enediyne antitumor antibiotic C-1027 featuring beta-amino acyl-S-carrier protein intermediates. (J Am Chem Soc. , 2005)
[17887753] Regiospecific chlorination of (S)-beta-tyrosyl-S-carrier protein catalyzed by SgcC3 in the biosynthesis of the enediyne antitumor antibiotic C-1027. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>FADH2-dependent (S)-beta-tyrosyl-PCP halogenase [alkylhalidase]
MDVSAQYDVIVVGGGPAGSTVSTLVRKRGHRVLQLEKETFPRYQIGESLLPSTVHGIAHL
LGVSDELKKAAFTIKHGGTFKWGANPEPWTFDFAVSRRMPGATGYAYQVERMKFDQILLD
NARRHGVEVRENSDVLDVLKAEDGRVRGVRYRDSEGREHEVGSRFVVDASGNTGGLYKKS
GAKREYSPFFRNLALFGYFNGGKRLPKPNSGNIFTCTFEHGWFWYIPLSPELTSVGAVVN
RDSASLVQGDPEKAMESFIAACPLIAEKLSEATRVTEGPYGELRVRKDWSYSNTKFWAPG
MALVGDAACFVDPVFSSGVHLATYSGLLAARSLNSCLDGSVDETSAFEEFEARYRLEYGR
FYEFLVGFYDMHHSEDSYFWQARKISNTADSDLQSFVELIGGVSSDEFADTARARQRFSE
ASDEMAGMTHTAAGDADGPHGAVPGKVVGRLMEQSAALQARALLGDEAGAERPVRQGGLA
ASTDGLGWVPGARS
selected fasta
>FADH2-dependent (S)-beta-tyrosyl-PCP halogenase [alkylhalidase]
GTGGACGTGTCAGCGCAGTACGACGTCATCGTGGTCGGCGGAGGTCCGGCGGGCTCGACC
GTCTCCACGCTGGTCCGCAAGCGGGGCCATCGCGTACTCCAGCTGGAGAAGGAGACCTTC
CCGCGCTACCAGATCGGTGAGTCGCTCCTCCCCTCCACCGTCCACGGCATCGCACACCTC
CTCGGTGTCTCCGACGAGCTGAAGAAGGCAGCCTTCACGATCAAGCACGGCGGGACGTTC
AAGTGGGGTGCCAACCCCGAACCGTGGACGTTCGACTTCGCCGTCTCGCGCCGGATGCCG
GGGGCGACGGGGTACGCGTACCAGGTCGAGCGCATGAAGTTCGACCAGATCCTGCTCGAC
AACGCTCGCAGGCACGGTGTCGAGGTGCGGGAGAACAGCGATGTCCTCGACGTGCTCAAG
GCCGAGGACGGCCGGGTGCGGGGCGTGCGCTACCGGGACTCCGAGGGGCGCGAGCACGAG
GTGGGCTCCCGTTTCGTCGTGGACGCCTCCGGCAACACCGGTGGGCTGTACAAGAAGTCG
GGCGCCAAGCGCGAGTACTCGCCCTTCTTCCGCAACCTGGCCCTGTTCGGCTACTTCAAC
GGCGGCAAGCGGCTTCCGAAGCCGAACTCCGGGAACATCTTCACCTGCACCTTCGAGCAC
GGGTGGTTCTGGTACATACCCCTGTCTCCCGAGCTGACGAGTGTCGGCGCAGTGGTGAAC
CGGGACTCGGCGAGCCTGGTGCAGGGCGACCCCGAGAAGGCGATGGAGTCGTTCATCGCG
GCCTGCCCGCTGATCGCGGAGAAGCTCTCCGAGGCCACCCGGGTGACCGAGGGCCCCTAC
GGCGAGCTCCGGGTCCGCAAGGACTGGTCGTACAGCAACACGAAGTTCTGGGCGCCGGGC
ATGGCCCTGGTCGGGGATGCCGCGTGCTTCGTCGACCCGGTGTTCTCCTCCGGGGTGCAC
CTCGCCACCTACAGCGGACTGCTGGCAGCGCGCTCGCTCAACTCCTGCCTGGACGGGTCG
GTCGACGAGACCAGCGCGTTCGAGGAGTTCGAGGCCCGCTACCGGCTGGAGTACGGCCGC
TTCTACGAGTTCCTGGTCGGCTTCTACGACATGCACCATTCGGAGGACTCCTATTTCTGG
CAGGCCCGGAAGATCTCCAACACCGCGGACTCCGACCTGCAGTCCTTCGTCGAACTGATC
GGCGGGGTCTCCTCCGACGAGTTCGCCGACACGGCCCGGGCCAGGCAGCGGTTCTCCGAG
GCGTCCGACGAGATGGCCGGCATGACGCACACCGCTGCGGGCGACGCCGACGGGCCGCAC
GGCGCCGTGCCGGGAAAGGTGGTGGGCCGCCTCATGGAGCAGAGCGCCGCACTGCAGGCA
CGGGCTCTTCTGGGGGATGAGGCGGGGGCCGAGCGACCGGTGAGGCAGGGGGGTCTGGCC
GCGTCGACGGACGGGCTGGGCTGGGTTCCCGGTGCGCGGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [8-30]  1.60000065022528e-05 PR00420 [298-313]  1.60000065022528e-05 PR00420
PR00420   RNGMNOXGNASE
IPR006905 Tryptophan halogenase (Family)
 [8-95]  9.9e-21 PF04820 [102-408]  1.2e-59 PF04820
PF04820   Trp_halogenase
SignalP No significant hit
TMHMM No significant hit