close all open/close all

CDS information : C1027_00100


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction13,012 / 14,079 / + [in whole cluster]
13,012 / 14,079 / + [in contig]
Location13012..14079 [in whole cluster]
13012..14079 [in contig]
TypeCDS
Length1,068 bp (355 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglucose-1-phosphate thymidylyltransferase
dTDP-glucose synthase
Product (GenBank)dNTP-glucose synthase
GenesgcA1
Gene (GenBank)
EC number2.7.7.24
Keyword
  • deoxy aminosugar
Note
Note (GenBank)
  • ORF10
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[14987060] Biochemical characterization of the SgcA1 alpha-D-glucopyranosyl-1-phosphate thymidylyltransferase from the enediyne antitumor antibiotic C-1027 biosynthetic pathway and overexpression of sgcA1 in Streptomyces globisporus to improve C-1027 production. (J Nat Prod. , 2004)

close this sectionSequence

selected fasta
>glucose-1-phosphate thymidylyltransferase [dNTP-glucose synthase]
MKALVLSGGSGTRLRPISYAMPKQLVPIAGKPVLEYVLDNIRNLDIKEVAIVVGDWAQEI
IEAMGDGSRFGLRLTYIRQEQPLGIAHCVKLARDFLDEDDFVLYLGDIMLDGDLSAQAGH
FLHTRPAARIVVRQVPDPRAFGVIELDGEGRVLRLVEKPREPRSDLAAVGVYFFTADVHR
AVDAISPSRRGELEITDAIQWLLEQGLPVEAGRYTDYWKDTGRVEDVVECNRRMLGRLAL
QVSGEVDPESELVGAVVVEEGARVTRSRVVGPAVIGAGTVVEDSQIGPYASIGRRCTVRA
SRLSDSIVLDDASILAVSGLHGSLIGRGARIAPGARGEARHRLVVGDHVQIEIAA
selected fasta
>glucose-1-phosphate thymidylyltransferase [dNTP-glucose synthase]
ATGAAGGCACTTGTACTGTCGGGTGGTTCGGGGACCCGCCTGCGCCCGATCAGTTACGCC
ATGCCGAAGCAGCTCGTTCCGATCGCCGGGAAGCCAGTCCTTGAATATGTTCTGGATAAT
ATCCGGAACCTCGATATCAAAGAGGTCGCCATTGTCGTCGGTGACTGGGCTCAGGAAATT
ATTGAGGCAATGGGTGACGGCAGCCGTTTCGGTCTGCGCCTCACCTACATACGCCAGGAG
CAACCTCTGGGCATCGCGCACTGCGTGAAACTGGCCCGAGACTTCCTCGACGAGGACGAC
TTCGTCCTCTACCTAGGCGACATCATGCTGGACGGAGACCTGTCCGCGCAGGCGGGGCAC
TTCCTCCACACCCGCCCCGCCGCGCGGATCGTCGTGCGCCAGGTGCCCGACCCCCGGGCC
TTCGGGGTGATCGAGCTGGACGGCGAAGGGCGTGTGCTGCGCCTGGTCGAGAAACCCCGT
GAACCGCGCAGCGACCTCGCGGCGGTCGGCGTGTACTTCTTCACCGCGGACGTGCACCGC
GCCGTCGACGCGATTAGCCCGAGCCGACGGGGCGAGCTGGAAATCACCGACGCCATCCAG
TGGCTGCTGGAGCAGGGCCTGCCGGTCGAGGCCGGCCGCTACACGGACTACTGGAAGGAC
ACCGGCCGGGTCGAGGACGTCGTGGAGTGCAACCGGCGGATGCTCGGCCGTCTGGCGCTC
CAGGTGTCGGGCGAGGTGGACCCGGAGAGCGAACTGGTGGGTGCGGTGGTCGTCGAGGAG
GGCGCCCGGGTGACGCGTTCGCGGGTCGTGGGACCAGCGGTGATCGGCGCGGGCACGGTC
GTCGAGGACAGCCAGATCGGACCGTACGCCTCCATCGGCCGGCGCTGCACCGTGCGGGCG
TCCCGGCTCTCCGACTCCATCGTCCTTGACGACGCCTCGATCCTCGCGGTGAGCGGACTG
CACGGCTCGCTGATCGGAAGGGGCGCGCGGATCGCGCCCGGGGCCCGGGGCGAGGCCCGG
CACCGGCTGGTCGTCGGCGACCACGTGCAGATCGAGATCGCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-234]  2.89999999999999e-53 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-352]  7.40000000000007e-119 TIGR01208
TIGR01208   RmlA_long
SignalP No significant hit
TMHMM No significant hit