close all open/close all

CDS information : C1027_00110


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction14,643 / 14,212 / - [in whole cluster]
14,643 / 14,212 / - [in contig]
Locationcomplement(14212..14643) [in whole cluster]
complement(14212..14643) [in contig]
TypeCDS
Length432 bp (143 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
ProductC-1027 apoprotein
Product (GenBank)C-1027 apoprotein
GenecagA
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • CagA
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
Q06110
PmId
[1368692] Purification and primary structure of C-1027-AG, a selective antagonist of antitumor antibiotic C-1027, from Streptomyces globisporus. (Agric Biol Chem. , 1991)
[1369059] Cloning and nucleotide sequencing of the antitumor antibiotic C-1027 apoprotein gene. (Biosci Biotechnol Biochem. , 1992)
[8373405] Specific interaction between a novel enediyne chromophore and apoprotein in macromolecular antitumor antibiotic C-1027. (Biochem Biophys Res Commun. , 1993)
[19845765] Disruption of cagA, the apoprotein gene of chromoprotein antibiotic C-1027, eliminates holo-antibiotic production, but not the cytotoxic chromophore. (FEMS Microbiol Lett. , 2009)

close this sectionSequence

selected fasta
>C-1027 apoprotein [C-1027 apoprotein]
MSLRHMSRRASRFGVVAVASIGLAAAAQSVAFAAPAFSVSPASGLSDGQSVSVSVSGAAA
GETYYIAQCAPVGGQDACNPATATSFTTDASGAASFSFVVRKSYTGSTPEGTPVGSVDCA
TAACNLGAGNSGLDLGHVALTFG
selected fasta
>C-1027 apoprotein [C-1027 apoprotein]
ATGTCGTTACGTCACATGTCCCGCCGTGCTTCCAGGTTCGGCGTCGTGGCCGTCGCATCC
ATCGGCCTGGCCGCCGCCGCACAGTCCGTCGCCTTCGCCGCGCCCGCCTTCTCCGTCAGT
CCCGCCTCGGGTCTGAGTGACGGACAGAGCGTGTCGGTGTCGGTCAGCGGTGCCGCCGCC
GGCGAGACCTACTACATCGCCCAGTGCGCTCCGGTCGGTGGCCAGGACGCGTGCAACCCG
GCGACCGCGACGTCCTTCACCACGGACGCGTCCGGAGCGGCGTCGTTCAGCTTCGTCGTG
CGCAAGTCGTACACGGGCTCCACGCCCGAAGGCACGCCGGTCGGCAGCGTCGACTGCGCC
ACGGCCGCCTGTAACCTCGGCGCCGGCAACTCCGGGCTCGACCTCGGCCACGTGGCTCTG
ACCTTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002186 Neocarzinostatin-type antitumour, antibiotic chromoprotein (Family)
 [34-53]  7.4e-41 PR01885 [57-72]  7.4e-41 PR01885 [87-104]  7.4e-41 PR01885 [111-127]  7.4e-41 PR01885
PR01885   MACROMOMYCIN
 [33-143]  3e-44 G3DSA:2.60.40.230
G3DSA:2.60.40.230   no description
 [34-143]  3.5e-43 SSF49319
SSF49319   Actinoxanthin-like
 [36-143]  1.3e-45 PF00960
PF00960   Neocarzinostat
 [62-143]  2e-41 PD012709
PD012709   CAGA_STRGL_Q06110;
SignalP
 [1-33]  0.842 Signal
Bacteria, Gram-positive   
 [1-26]  0.594 Signal
Eukaryota   
 [1-33]  0.727 Signal
Bacteria, Gram-negative   
TMHMM
 [13-35]  Transmembrane (i-o)
Transmembrane 1