close all open/close all

CDS information : C1027_00120


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction15,922 / 14,690 / - [in whole cluster]
15,922 / 14,690 / - [in contig]
Locationcomplement(14690..15922) [in whole cluster]
complement(14690..15922) [in contig]
TypeCDS
Length1,233 bp (410 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 aminotransferase
Product (GenBank)amino transferase
GenesgcA4
Gene (GenBank)
EC number2.6.1.-
Keyword
  • deoxy aminosugar
Note
Note (GenBank)
  • ORF8
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
O33942
PmId
[9353926] Sequencing and mutagenesis of genes from the erythromycin biosynthetic gene cluster of Saccharopolyspora erythraea that are involved in L-mycarose and D-desosamine production. (Microbiology. , 1997)
ACC
Q331S0
PmId
[17532307] Enzymatic synthesis of dTDP-4-amino-4,6-dideoxy-D-glucose using GerB (dTDP-4-keto-6-deoxy-D-glucose aminotransferase). (Carbohydr Res. , 2007)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 aminotransferase [amino transferase]
MSGGPVRLDSLPTPYFSEPLHVGRPNVGSRDRLMERIDGALERLWFTNDGPLVREFEARV
AELTQVRHCVAVSNATTGIQVAAKALGIGPGDEVIVPSFTWVATAHALDWIGAVPVFCEL
DEETGTADVAHVERLIGPRTRAILDVHVFGRPARIDELTKLAAEHGLHLLFDAAHAFGCT
YRSKPIGGFGTAEIFSFQATKFVNSFEGGAIVTDDDALADRLRAMRHQGLNAAHEITGSG
TVARMHEISAAMGLTSLESADHFTAINRRNYRLYEQYLDGLPGVRVRPQDPNELSNCQYV
VIEVDAVRAGLHRDELQAVLQRHNVLARAYFSPGCHSCEPYRSDLARHAPDPLPKVEALT
ERVLSLPTGTAVGPEEVRGVCRILRAAVDGSAVPEIHESTEGDAGGRPAR
selected fasta
>putative NDP-hexose C-4 aminotransferase [amino transferase]
ATGAGCGGCGGCCCGGTGCGTCTGGACTCCCTACCCACGCCCTACTTCAGCGAACCGCTG
CACGTGGGACGCCCGAACGTGGGCTCCCGCGACCGTTTGATGGAACGGATCGACGGGGCG
CTGGAGCGCCTGTGGTTCACCAATGACGGCCCCCTGGTCCGGGAGTTCGAGGCCCGTGTG
GCCGAGCTGACCCAGGTCAGGCACTGCGTCGCCGTATCGAACGCCACCACCGGCATCCAG
GTCGCCGCGAAGGCCCTGGGCATCGGTCCTGGGGACGAGGTGATCGTGCCCTCCTTCACC
TGGGTCGCCACCGCCCACGCACTGGACTGGATCGGTGCGGTGCCTGTCTTCTGCGAACTG
GACGAGGAGACCGGAACCGCGGACGTGGCACACGTGGAGCGGCTCATCGGCCCGCGTACC
CGCGCCATCCTGGACGTGCACGTCTTCGGCAGACCGGCCCGGATCGACGAGCTGACCAAG
CTGGCCGCCGAGCACGGGCTGCACCTGCTCTTCGATGCCGCCCACGCCTTCGGCTGCACC
TACCGGTCGAAGCCGATCGGCGGCTTCGGCACGGCGGAGATCTTCAGCTTCCAGGCGACG
AAGTTCGTGAACAGCTTCGAGGGCGGGGCGATCGTCACCGACGACGACGCCCTGGCCGAC
CGGCTCCGGGCCATGCGCCACCAGGGGCTCAACGCCGCGCATGAGATCACCGGGAGCGGA
ACGGTCGCGCGGATGCACGAGATCAGCGCGGCCATGGGCCTCACCTCCCTGGAGTCCGCC
GATCACTTCACCGCGATCAACCGGCGCAACTACCGTCTGTACGAGCAGTACCTCGACGGA
CTGCCCGGCGTCCGGGTCCGCCCGCAGGATCCGAACGAGCTGTCGAACTGCCAGTACGTC
GTCATCGAGGTGGACGCCGTCCGCGCCGGGCTGCACCGCGACGAACTCCAGGCGGTGCTC
CAACGGCACAACGTCCTGGCCCGCGCCTACTTCAGCCCCGGCTGCCACAGCTGCGAGCCC
TACCGGTCCGACCTCGCGCGCCACGCGCCCGATCCGCTCCCGAAGGTGGAGGCGCTCACC
GAGCGGGTGCTGTCGCTGCCCACCGGTACGGCGGTGGGGCCGGAGGAGGTGCGGGGGGTC
TGCCGCATTCTGCGGGCGGCCGTCGACGGGAGTGCCGTGCCGGAAATCCACGAGAGCACA
GAGGGAGATGCAGGCGGCCGTCCGGCGAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [2-392]  1.79999754022378e-109 PIRSF000390
PIRSF000390   PLP_StrS
 [35-384]  3.60000000000002e-101 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [20-258]  1.9e-73 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [261-389]  5.59999999999999e-23 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [18-391]  1.69998802370953e-90 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit