close all open/close all

CDS information : C1027_00130


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction16,653 / 15,919 / - [in whole cluster]
16,653 / 15,919 / - [in contig]
Locationcomplement(15919..16653) [in whole cluster]
complement(15919..16653) [in contig]
TypeCDS
Length735 bp (244 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose N,N-dimethyltransferase
Product (GenBank)N-methyl transferase
GenesgcA5
Gene (GenBank)
EC number2.1.1.-
Keyword
  • deoxy aminosugar
Note
Note (GenBank)
  • ORF7
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
Q9L4U1
NITE
Acla_00260
PmId
[11016846] A gene cluster from Streptomyces galilaeus involved in glycosylation of aclarubicin. (Mol Gen Genet. , 2000)
[12427929] Characterization of mutations in aclacinomycin A-non-producing Streptomyces galilaeus strains with altered glycosylation patterns. (Microbiology. , 2002)
ACC
Q9ALP0
NITE
Spino_00030
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose N,N-dimethyltransferase [N-methyl transferase]
MEYGPEHAKFYDLVFRSRGKDFDLEARGLTELILAARPDAVSLLDVACGTGAHLETLATL
FGHVEGLEYAPAMLEQAAGRLPGVPLHAGDMRSFDLGRTFDAITCMGNALGEMGSVTELK
AAVSAMAHHLNPGGVLVAEPWYFPENFLDGHVGGHLHQEEGRVITRMTHSVRQGDKSRLE
VRFRVADASGFREFSEVLTSSLFTREQYTDAFESVGLSVRFVPGFRLADGRPNSPGLFVG
VRTA
selected fasta
>putative NDP-hexose N,N-dimethyltransferase [N-methyl transferase]
ATGGAGTACGGCCCCGAGCACGCGAAGTTCTACGACCTCGTGTTCCGCAGCCGCGGCAAG
GACTTCGACCTGGAGGCCCGCGGGCTCACCGAGCTGATCCTCGCCGCCCGCCCCGACGCC
GTGTCGCTCCTGGACGTCGCCTGCGGCACCGGAGCCCATCTGGAGACGCTCGCCACGCTC
TTCGGCCATGTGGAGGGCCTCGAGTACGCGCCCGCGATGCTGGAGCAGGCGGCGGGCCGG
CTTCCCGGCGTCCCGCTGCACGCCGGTGACATGCGTTCGTTCGACCTGGGCCGCACCTTC
GACGCGATCACCTGCATGGGCAACGCGCTCGGCGAGATGGGGTCCGTCACCGAGCTCAAG
GCCGCGGTGTCGGCCATGGCCCACCACCTGAACCCCGGGGGAGTCCTCGTCGCCGAACCC
TGGTATTTCCCCGAGAACTTCCTCGACGGGCATGTCGGCGGCCATCTGCACCAGGAGGAG
GGCCGTGTCATCACGCGGATGACGCACTCCGTGCGCCAGGGCGACAAGTCACGTCTGGAG
GTCCGGTTCCGGGTCGCGGACGCCTCCGGCTTCAGAGAGTTCTCCGAGGTCCTGACCTCC
AGCCTCTTCACCCGCGAGCAGTACACCGACGCCTTCGAATCGGTGGGGCTCTCGGTGCGG
TTCGTGCCCGGCTTCCGGCTGGCCGACGGCCGGCCCAACAGCCCCGGCCTCTTCGTCGGC
GTGCGCACGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit