close all open/close all

CDS information : C1027_00140


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction17,924 / 16,653 / - [in whole cluster]
17,924 / 16,653 / - [in contig]
Locationcomplement(16653..17924) [in whole cluster]
complement(16653..17924) [in contig]
TypeCDS
Length1,272 bp (423 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-methyltransferase
Product (GenBank)C-methyl transferase
GenesgcA3
Gene (GenBank)
EC number2.1.1.-
Keyword
  • deoxy aminosugar
Note
Note (GenBank)
  • ORF6
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
Q8GHA8
PmId
[16849806] Biosynthesis of the unusual 5,5-gem-dimethyl-deoxysugar noviose: investigation of the C-methyltransferase gene cloU. (Microbiology. , 2006)

close this sectionSequence

selected fasta
>putative NDP-hexose C-methyltransferase [C-methyl transferase]
MLEKCRRDETCRVCGADDWTEVISFGSLPLANGFVDPADADEAQDVFPLDVIVCRSCRLM
TLRHVVDPGTLFKHYVYVSSDSDQIREHMAHIVGLATRRASLASGDLVVELGSNVGTQLA
MFRAAGMRVAGVDPAANLAEIANARGIPTDPDFFGPEPAGRIALEQGRAKAVIGRQCFAH
IDDVHRILDGVDAVLDDDGVLVIEVPYLLNLLDENQFDTIYHEHLSYFSLHTLRHLFGAH
GLRIIDVERVAVHGGSIAVVAARESAARVPEPSVAALLGLEEERGLLTDAPYRAFAERVT
RVTEAIRTLVRGLAADGHRVAGYGAPSKGTQLLMACGLTDQDITVCGDTTSLKHGKLLPG
NRIPVLPPEEVAATEPDYYLLLAWNYTDEVVRKERRFLEAGGKFIVPIPEPRIISAQSAK
ELV
selected fasta
>putative NDP-hexose C-methyltransferase [C-methyl transferase]
ATGCTGGAGAAATGCAGGCGGGACGAGACGTGCCGTGTATGCGGTGCGGACGACTGGACC
GAGGTGATCTCCTTCGGCTCGCTGCCGCTGGCCAACGGGTTCGTCGATCCGGCCGACGCC
GATGAGGCGCAGGACGTCTTCCCGCTCGACGTCATCGTGTGCCGGTCGTGCCGGCTGATG
ACGCTTCGCCATGTCGTCGACCCCGGGACACTGTTCAAGCACTACGTCTACGTCTCCTCC
GACTCCGACCAGATCCGCGAGCACATGGCGCACATCGTCGGGCTGGCGACCCGCCGGGCA
AGCCTCGCCTCCGGCGACCTGGTCGTGGAGCTGGGCAGCAACGTCGGCACCCAGCTCGCG
ATGTTCCGGGCGGCGGGCATGCGGGTGGCCGGGGTCGACCCGGCGGCCAACCTCGCCGAG
ATCGCCAACGCCCGGGGGATCCCCACGGACCCGGACTTCTTCGGCCCGGAGCCCGCGGGC
CGCATCGCCCTTGAGCAGGGCAGGGCCAAGGCCGTCATCGGCCGCCAGTGCTTCGCGCAC
ATCGACGACGTGCACCGCATCCTGGACGGCGTCGACGCAGTGCTCGACGACGACGGCGTC
CTGGTCATCGAGGTGCCGTACCTGCTGAACCTGCTCGACGAGAACCAGTTCGACACGATC
TACCACGAGCACCTGTCGTACTTCTCCCTGCACACACTGCGCCACCTCTTCGGCGCGCAC
GGCCTGCGGATCATCGACGTGGAGCGGGTCGCCGTGCACGGCGGTTCGATCGCGGTCGTC
GCCGCGCGCGAGTCGGCCGCACGGGTCCCGGAGCCCTCGGTCGCGGCGCTGCTCGGCCTG
GAGGAGGAGCGCGGACTGCTGACGGATGCCCCCTACCGGGCGTTCGCCGAGCGGGTGACG
CGCGTGACCGAAGCGATCCGTACGCTCGTTCGCGGTCTGGCCGCGGACGGCCACCGCGTG
GCCGGCTACGGAGCACCGTCCAAGGGGACCCAGTTGCTGATGGCCTGCGGTCTGACGGAT
CAGGACATCACCGTCTGCGGCGACACCACCAGCCTCAAGCACGGCAAACTGCTGCCGGGG
AACCGCATCCCGGTCCTTCCTCCGGAGGAGGTCGCTGCCACCGAGCCGGACTACTACCTC
CTCCTCGCCTGGAACTACACCGACGAGGTCGTCCGCAAGGAGCGCCGCTTCCTGGAGGCG
GGAGGGAAGTTCATCGTTCCCATCCCGGAGCCCAGAATCATCTCCGCCCAGTCTGCGAAG
GAGCTCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013630 Methyltransferase putative zinc binding domain (Domain)
 [11-73]  7.1e-23 PF08421
PF08421   Methyltransf_13
IPR013691 C-methyltransferase (Domain)
 [251-409]  2.4e-56 PF08484
PF08484   Methyltransf_14
SignalP No significant hit
TMHMM No significant hit