close all open/close all

CDS information : C1027_00150


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction19,188 / 18,031 / - [in whole cluster]
19,188 / 18,031 / - [in contig]
Locationcomplement(18031..19188) [in whole cluster]
complement(18031..19188) [in contig]
TypeCDS
Length1,158 bp (385 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productepoxide hydrolase
Product (GenBank)epoxide hydrolase
GenesgcF
Gene (GenBank)
EC number
Keyword
  • enediyne core
  • inverting type
Note
Note (GenBank)
  • ORF17
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[19856960] Characterization of the SgcF epoxide hydrolase supporting an (R)-vicinal diol intermediate for enediyne antitumor antibiotic C-1027 biosynthesis. (J Am Chem Soc. , 2009)
[23844627] Predictive model for epoxide hydrolase-generated stereochemistry in the biosynthesis of nine-membered enediyne antitumor antibiotics. (Biochemistry. , 2013)

close this sectionSequence

selected fasta
>epoxide hydrolase [epoxide hydrolase]
MRPFRIEIDQSDIDDLNRRIDATRWPSEIPGSGWDRGVPLSYLKELTDHWRHGYDWRAAE
AELNAFPQFVTTIDGADVHFLHVRSPEPDAIPLILTHGWPGSVAEFLDVIGPLSDPRAHG
GDPADAFHVVVPSMPGYGFSGPTAEPGWDVRRIARAWAELMNRLGYERYVAQGGDWGKVV
SLELGLADPEHVAGVHLNMLVTFPPQDAPEAIGRLDESDLGKLAHSGEFADTGIGWQRIQ
ATRPQTLAYGLTDSPVGQLAWILDKFQEWSGGKNVEEAISRDRLLTHVMIYWLTATAGSS
AQLYYESARGMADFARTWGGPWPLTAPVGVAVFPDDATRPIRSFAEGILPTLTRWTEFDR
GGHFAAMEQPQLLIEDVRAFTRPLR
selected fasta
>epoxide hydrolase [epoxide hydrolase]
GTGCGTCCCTTCCGTATCGAGATCGACCAGTCCGACATCGACGACCTGAACCGCCGGATC
GACGCGACCCGGTGGCCGTCGGAGATACCCGGATCCGGATGGGACCGCGGAGTGCCGCTG
TCCTACCTCAAGGAGCTCACCGACCACTGGCGCCACGGCTACGACTGGCGTGCCGCGGAG
GCCGAGCTGAACGCGTTCCCCCAGTTCGTCACCACGATCGACGGCGCCGACGTGCACTTC
CTTCACGTGCGTTCGCCCGAGCCGGACGCGATCCCGCTGATCCTCACCCACGGCTGGCCG
GGCTCGGTCGCCGAGTTCCTCGACGTCATCGGGCCGCTGAGCGACCCGCGCGCGCACGGC
GGCGACCCGGCGGACGCCTTCCACGTCGTCGTCCCCTCCATGCCGGGCTACGGCTTCTCC
GGCCCGACTGCCGAGCCGGGCTGGGACGTGCGGCGGATCGCACGCGCCTGGGCGGAGCTG
ATGAACCGCCTCGGCTACGAGCGTTACGTCGCCCAGGGCGGCGACTGGGGAAAGGTCGTC
TCGCTGGAGCTGGGGCTGGCCGACCCCGAGCACGTGGCCGGCGTCCACCTGAACATGCTG
GTGACCTTCCCGCCCCAGGACGCCCCGGAGGCCATCGGGCGCCTGGACGAGAGCGACCTG
GGCAAGCTGGCGCACAGCGGGGAGTTCGCCGACACCGGCATCGGCTGGCAGCGCATCCAG
GCCACCCGCCCGCAGACCCTGGCCTACGGCCTCACCGACTCCCCGGTCGGCCAGCTCGCC
TGGATTCTCGACAAGTTCCAGGAGTGGAGCGGCGGCAAGAACGTGGAGGAGGCCATCTCC
CGGGACCGGCTGCTCACCCACGTGATGATCTACTGGCTGACCGCGACGGCCGGTTCCAGC
GCTCAGTTGTACTACGAGTCGGCTCGCGGCATGGCGGACTTCGCCCGCACCTGGGGCGGG
CCCTGGCCGCTGACGGCCCCCGTCGGCGTCGCGGTGTTCCCGGACGACGCCACCCGGCCG
ATCCGGTCGTTCGCCGAGGGCATCCTGCCGACCCTGACGCGGTGGACCGAGTTCGACCGC
GGCGGGCACTTCGCGGCCATGGAGCAGCCGCAGCTCCTCATCGAGGACGTACGGGCGTTC
ACCCGTCCGCTCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000073 Alpha/beta hydrolase fold-1 (Domain)
 [127-201]  2e-07 PF00561
PF00561   Abhydrolase_1
IPR000639 Epoxide hydrolase-like (Family)
 [97-115]  4.09999599045784e-16 PR00412 [126-141]  4.09999599045784e-16 PR00412 [171-184]  4.09999599045784e-16 PR00412 [185-198]  4.09999599045784e-16 PR00412 [358-380]  4.09999599045784e-16 PR00412
PR00412   EPOXHYDRLASE
IPR010497 Epoxide hydrolase, N-terminal (Domain)
 [2-110]  6.6999999999999e-43 PF06441
PF06441   EHN
IPR016292 Epoxide hydrolase (Family)
 [1-385]  2.2999842048857e-122 PIRSF001112
PIRSF001112   Epoxide_hydrolase
SignalP No significant hit
TMHMM No significant hit