close all open/close all

CDS information : C1027_00160


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction19,924 / 19,262 / - [in whole cluster]
19,924 / 19,262 / - [in contig]
Locationcomplement(19262..19924) [in whole cluster]
complement(19262..19924) [in contig]
TypeCDS
Length663 bp (220 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)anthranilate synthase II
GenesgcD1
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF16
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [anthranilate synthase II]
MSLWSPDGSGAGTEAPRVLVVDAFDSFVDILRQYLMSAGAEPVMVRSHLMTPDEMGLMRP
DAVLLGPGPGHPDTSGHVEIVQAFAGRVPLLGVCLGHQAVARAYGAATVPARHLMHGKTS
RITHDGRGVFTGLPAGFFATRYHSLIVPEGTVPPSLEVTARSTDDGYVMGLRHRSLPVES
VQFHPESFRTEHGMPMIRNFLSSVRSFSAREGAAAPAEAA
selected fasta
>hypothetical protein [anthranilate synthase II]
GTGAGCTTGTGGTCTCCCGACGGATCCGGCGCAGGCACCGAGGCCCCGCGGGTCCTGGTG
GTCGACGCGTTCGACAGCTTCGTCGACATCCTGCGCCAGTATCTGATGTCCGCCGGCGCG
GAGCCCGTCATGGTGCGGTCGCATCTCATGACCCCGGACGAGATGGGGCTGATGCGGCCG
GACGCGGTCCTGCTGGGGCCGGGCCCCGGCCACCCCGACACCTCCGGGCACGTCGAGATC
GTCCAGGCCTTCGCCGGCCGGGTCCCGCTGCTCGGGGTCTGTCTGGGGCATCAGGCCGTC
GCCCGCGCCTACGGCGCCGCCACCGTCCCCGCCCGGCATCTCATGCACGGGAAGACGAGC
CGGATCACGCACGACGGGCGCGGAGTGTTCACCGGGCTGCCCGCGGGGTTCTTCGCGACC
CGCTACCACTCACTGATCGTGCCGGAGGGCACGGTCCCGCCGTCCCTCGAGGTCACCGCG
CGCTCCACGGACGACGGCTACGTGATGGGCCTGCGCCACCGTTCGCTGCCGGTGGAGTCC
GTCCAGTTCCATCCGGAGAGCTTCCGGACCGAACACGGCATGCCGATGATCCGCAACTTC
CTGTCCTCCGTGCGGTCCTTCTCCGCACGGGAAGGCGCGGCCGCGCCGGCCGAAGCGGCC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006221 Anthranilate synthase/para-aminobenzoate synthase, glutamine amidotransferase (Family)
 [18-202]  2.89999999999999e-55 TIGR00566
TIGR00566   TrpG_papA
IPR017926 Glutamine amidotransferase type 1 (Domain)
 [19-201]  6.59999999999996e-47 PF00117
PF00117   GATase
 [17-210]  PS51273
PS51273   GATASE_TYPE_1
SignalP No significant hit
TMHMM No significant hit