close all open/close all

CDS information : C1027_00170


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction21,402 / 19,921 / - [in whole cluster]
21,402 / 19,921 / - [in contig]
Locationcomplement(19921..21402) [in whole cluster]
complement(19921..21402) [in contig]
TypeCDS
Length1,482 bp (493 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Product2-amino-2-deoxyisochorismate synthase
Product (GenBank)anthranilate synthase I
GenesgcD
Gene (GenBank)
EC number
Keyword
  • benzoxazolinate
Note
Note (GenBank)
  • ORF15
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[18182490] Biosynthesis of the enediyne antitumor antibiotic C-1027 involves a new branching point in chorismate metabolism. (Proc Natl Acad Sci U S A. , 2008)

close this sectionSequence

selected fasta
>2-amino-2-deoxyisochorismate synthase [anthranilate synthase I]
MTDQCVVSAPVRVRTRRLDVKETGALPAYRALAEHFGPDEVYLLESAAGPARDRRHQFVG
FGALLSLSVTDRVVRVEGVPALRGLLLERAGALLEDGPQGLRLRTAGGLWPLLRAMRDMF
DAEGSASGFRFGFLGFFGYDTARYIEDLPHLIENRPGLPDVRMVLHRGSVVTDLATGRCE
LLLHESPYWPGLAPETVTGLLADVEQAWPDPSADGFPASAVTDDSAPEVFANDVERCLKH
IAVGDIYQVQIGHELSIRSTADPADVYQRLRGRNASPYMYLAGIDGHRLIGASPELFVRI
EDGEVTMRPIAGTVPRSGADGGIAAGVRLRSDPKEIAEHTMLVDLCRNDIGRIARPNTLD
VPDQLDVEGYSHVLHLVSTVVGRARVDTDAFDTIAALFPAGTMTGAPKIRAMEIIESVER
SRRGLYAGALGLLDVGGYTNLALCIRTLFHHEGVYRTRASAGIVADSEPGAEWTETLAKM
SATHWAVTGEELL
selected fasta
>2-amino-2-deoxyisochorismate synthase [anthranilate synthase I]
ATGACCGACCAGTGCGTGGTCTCGGCCCCGGTGCGGGTGCGGACACGACGCCTCGATGTG
AAGGAGACGGGCGCCCTGCCCGCCTACCGCGCGCTGGCCGAGCACTTCGGCCCCGACGAG
GTCTACCTCCTGGAGTCCGCGGCCGGCCCGGCCCGCGACCGCAGGCACCAGTTCGTCGGC
TTCGGCGCGCTGCTCTCGCTCTCGGTCACCGACCGGGTGGTGCGCGTCGAGGGCGTACCC
GCCCTGCGGGGCCTGCTCCTGGAGCGGGCCGGCGCGCTCCTGGAGGACGGCCCCCAGGGG
CTGCGGCTGCGTACCGCGGGCGGGTTGTGGCCGCTGCTGCGGGCCATGCGGGACATGTTC
GACGCCGAGGGGTCCGCGTCCGGCTTCCGCTTCGGGTTCCTCGGGTTCTTCGGGTACGAC
ACGGCCCGCTACATCGAGGACCTGCCCCACCTCATCGAGAACCGGCCTGGCCTGCCGGAC
GTACGCATGGTCCTGCACCGGGGCAGCGTGGTCACCGATCTCGCCACCGGCCGATGCGAA
CTGCTGCTCCACGAGTCCCCGTACTGGCCCGGCCTCGCGCCGGAGACCGTCACCGGGCTC
CTCGCCGACGTGGAGCAGGCCTGGCCCGATCCGTCCGCAGACGGCTTCCCCGCCTCCGCG
GTCACCGACGACAGCGCCCCCGAAGTGTTCGCGAACGACGTCGAGCGGTGTCTGAAGCAC
ATCGCCGTCGGCGACATCTACCAGGTGCAGATCGGTCACGAGCTCTCCATCCGCTCGACG
GCCGACCCCGCGGACGTCTACCAGCGCCTGCGCGGGCGGAACGCCTCCCCGTACATGTAT
CTGGCGGGCATCGACGGGCACCGTCTGATCGGCGCCAGCCCCGAGCTGTTCGTACGCATC
GAGGACGGCGAGGTCACGATGCGGCCGATCGCGGGCACGGTGCCGCGGTCCGGCGCGGAC
GGCGGCATCGCCGCGGGAGTCCGGCTGAGGTCGGATCCCAAGGAGATCGCCGAGCACACC
ATGCTGGTGGACCTCTGCCGCAACGACATCGGACGGATCGCCCGGCCGAACACGCTCGAC
GTACCCGACCAGCTGGACGTGGAGGGCTACTCCCACGTGCTGCACCTGGTCTCCACGGTC
GTCGGCCGGGCGCGGGTGGACACCGATGCCTTCGACACCATCGCCGCCCTGTTCCCCGCC
GGCACCATGACGGGCGCGCCGAAGATCCGCGCCATGGAGATCATCGAGTCCGTCGAACGC
AGCCGCCGCGGCCTGTACGCCGGGGCGCTCGGCCTCCTCGACGTGGGCGGGTACACCAAC
CTCGCGCTGTGCATCCGGACCCTTTTCCACCACGAGGGCGTCTACCGCACCCGGGCCTCG
GCCGGAATCGTCGCCGATTCCGAACCGGGGGCGGAGTGGACCGAGACGCTGGCCAAGATG
AGCGCCACTCACTGGGCGGTCACCGGAGAGGAGTTGCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005801 ADC synthase (Domain)
 [16-487]  6.60000000000002e-126 G3DSA:3.60.120.10
G3DSA:3.60.120.10   TRPE_1_chor_bd
 [8-487]  1.39999277195148e-118 SSF56322
SSF56322   TRPE_1_chor_bd
IPR006805 Anthranilate synthase component I, N-terminal (Domain)
 [27-181]  2.6e-14 PF04715
PF04715   Anth_synt_I_N
IPR015890 Chorismate binding, C-terminal (Domain)
 [228-479]  6.99999999999989e-81 PF00425
PF00425   Chorismate_bind
IPR019999 Anthranilate synthase component I (Family)
 [327-340]  8.80000265836278e-15 PR00095 [341-354]  8.80000265836278e-15 PR00095 [421-435]  8.80000265836278e-15 PR00095 [436-450]  8.80000265836278e-15 PR00095
PR00095   ANTSNTHASEI
SignalP No significant hit
TMHMM No significant hit