close all open/close all

CDS information : C1027_00180


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction22,873 / 21,419 / - [in whole cluster]
22,873 / 21,419 / - [in contig]
Locationcomplement(21419..22873) [in whole cluster]
complement(21419..22873) [in contig]
TypeCDS
Length1,455 bp (484 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative ligase
Product (GenBank)putative phenylacetyl CoA ligase
GenesgcD5
Gene (GenBank)
EC number
Keyword
  • benzoxazolinate
Note
Note (GenBank)
  • ORf14
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[18182490] Biosynthesis of the enediyne antitumor antibiotic C-1027 involves a new branching point in chorismate metabolism. (Proc Natl Acad Sci U S A. , 2008)
Related Reference
ACC
O33469
PmId
[8969218] Molecular cloning and expression in different microbes of the DNA encoding Pseudomonas putida U phenylacetyl-CoA ligase. Use of this gene to improve the rate of benzylpenicillin biosynthesis in Penicillium chrysogenum. (J Biol Chem. , 1996)
Family/Domain
FD
IPR000873

close this sectionSequence

selected fasta
>putative ligase [putative phenylacetyl CoA ligase]
MRDGRRPGPGGTGPLDPDADSEFWSAYGQVSDAFYRGELTAADRERWEGERLTAVLRHVT
RRSPFYRRHLAGVDVEAVTPANLADLPFTTKDDLRREMHDVLSGPLHEARIYYETTGTTG
AATPCPRGEKDIATSNIAVRESWRRMLEARFGGRMPVVGLMGPSELYAFGDVFTAVAAEL
GACHVKIWPESPRVGFRKALRLIEELEVEVVVCAPALCLSLAKAALHYGYDLARLPVKLF
LTLGEICTPQFADNVATLWPQAVVRPTLYGSQEALCIATGADTGALHLAQPNYLTELVEP
DTGAVVGDTGEGELVLTMLVDGIKPLIRYRTGDLVRILPAGPGEPLPGPRIQVIGRVADR
IPLGDVTLQPAELEAAILDGVGGCLGYQVVIDRQDDGSDAVTVRMDLLAGAEGERQGIGE
AVAARLRERTGAHAGIVVDTDLDPVTHTGSFVSWKAARVVDNRSGPDRAVLTARQVAHRY
AITT
selected fasta
>putative ligase [putative phenylacetyl CoA ligase]
GTGAGAGACGGCCGGCGGCCCGGTCCCGGCGGGACCGGGCCGCTGGACCCCGACGCGGAC
AGCGAGTTCTGGTCCGCCTACGGGCAGGTGAGCGACGCGTTCTACCGCGGCGAACTCACC
GCCGCCGACCGCGAGCGCTGGGAGGGCGAACGGCTGACGGCCGTACTGCGCCACGTCACC
CGCCGCTCGCCGTTCTACCGCCGCCATCTGGCAGGCGTGGACGTCGAGGCCGTCACCCCC
GCGAACCTGGCGGACCTGCCCTTCACCACCAAGGACGACCTGCGGCGGGAGATGCACGAC
GTCCTGTCGGGCCCGCTGCACGAAGCACGCATCTACTACGAGACCACCGGGACCACCGGG
GCGGCCACCCCGTGCCCACGCGGCGAGAAGGACATCGCGACCAGCAACATCGCCGTCCGG
GAGTCCTGGCGCCGCATGCTGGAAGCGAGGTTCGGGGGGCGGATGCCCGTCGTGGGCCTG
ATGGGGCCGTCGGAGCTGTACGCGTTCGGGGACGTGTTCACCGCGGTGGCAGCGGAGCTG
GGGGCCTGTCACGTCAAGATCTGGCCCGAGTCCCCCAGGGTGGGATTCCGTAAGGCGCTG
CGGCTGATCGAGGAGCTGGAGGTCGAGGTCGTCGTCTGTGCTCCGGCGCTGTGCCTGAGC
CTTGCCAAGGCGGCCCTGCACTACGGCTACGACCTGGCCCGGCTTCCCGTGAAGCTCTTC
CTCACGCTGGGTGAGATCTGCACCCCGCAGTTCGCCGACAACGTGGCGACCCTCTGGCCG
CAAGCCGTCGTGCGGCCCACGCTCTACGGCTCCCAGGAAGCCCTGTGCATCGCCACCGGA
GCGGACACCGGAGCGCTCCACCTCGCCCAGCCCAACTACTTGACCGAACTCGTCGAACCG
GACACCGGCGCCGTGGTCGGCGACACGGGAGAGGGCGAACTCGTCCTCACCATGCTGGTG
GACGGCATCAAACCACTGATCCGCTACCGCACCGGGGACCTGGTCCGCATCCTCCCGGCG
GGCCCCGGGGAGCCGCTGCCGGGACCGCGGATCCAGGTCATCGGCCGGGTCGCGGACCGC
ATCCCCCTGGGCGACGTGACCCTCCAGCCCGCCGAGCTGGAGGCCGCGATCCTCGACGGG
GTCGGCGGCTGCCTCGGCTACCAGGTCGTCATCGACCGGCAGGACGACGGCAGCGACGCC
GTCACCGTGCGCATGGACCTGCTGGCCGGCGCCGAGGGGGAACGGCAGGGCATCGGCGAG
GCCGTCGCCGCCCGGCTCAGGGAGCGGACCGGCGCGCACGCCGGCATCGTCGTGGACACC
GACCTCGACCCCGTGACCCACACCGGCTCCTTCGTCAGCTGGAAGGCCGCGCGCGTCGTC
GACAACCGCTCCGGCCCCGACCGGGCGGTGCTGACCGCCCGTCAGGTGGCACACCGCTAC
GCCATCACCACGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [169-316]  1e-05 PF00501
PF00501   AMP-binding
SignalP No significant hit
TMHMM No significant hit