close all open/close all

CDS information : C1027_00190


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction23,541 / 22,870 / - [in whole cluster]
23,541 / 22,870 / - [in contig]
Locationcomplement(22870..23541) [in whole cluster]
complement(22870..23541) [in contig]
TypeCDS
Length672 bp (223 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
ProductFMN-dependent 2-amino-2-deoxyisochorismate dehydrogenase
Product (GenBank)hypothetical Fe-S flavoprotein
GenesgcG
Gene (GenBank)
EC number
Keyword
  • benzoxazolinate
Note
Note (GenBank)
  • ORF21
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[18182490] Biosynthesis of the enediyne antitumor antibiotic C-1027 involves a new branching point in chorismate metabolism. (Proc Natl Acad Sci U S A. , 2008)

close this sectionSequence

selected fasta
>FMN-dependent 2-amino-2-deoxyisochorismate dehydrogenase [hypothetical Fe-S flavoprotein]
MSAQLKILAINGSERDGNTADVLRHAARVAENRGVDFEAVDLRSIRMERCGPCGDCNDRP
VACTLADGVPEVVAKMVAADGIIFAAPVHGFGTASLMQTFIERAGVGYLRFDRPLSNKVA
GIISVARRYSAGEVWAQLTVNALLNRMILVGSGFPATVHALHRGDALKDEEGLTNVSRLV
ERMTDMIELLDEHRRLTGRSDVLASNEVNERVGLALNELQAQP
selected fasta
>FMN-dependent 2-amino-2-deoxyisochorismate dehydrogenase [hypothetical Fe-S flavoprotein]
GTGAGCGCACAACTCAAGATCCTCGCGATCAACGGTTCGGAACGTGACGGCAACACCGCC
GACGTACTGCGGCACGCGGCACGCGTAGCAGAGAACCGCGGCGTCGACTTCGAGGCCGTC
GACCTGCGCTCGATCAGGATGGAGCGGTGCGGGCCCTGCGGGGACTGCAACGACAGGCCG
GTGGCCTGCACCCTGGCCGACGGGGTGCCCGAGGTCGTGGCGAAGATGGTCGCGGCGGAC
GGGATCATCTTCGCGGCGCCCGTGCACGGATTCGGCACGGCCAGCCTCATGCAGACCTTC
ATCGAGCGTGCCGGAGTCGGTTATCTGCGCTTCGACCGGCCGCTGAGCAACAAGGTCGCG
GGGATCATCTCGGTCGCCCGCCGCTACAGCGCCGGCGAGGTATGGGCTCAGCTGACCGTC
AATGCCCTGCTCAACCGGATGATCCTGGTGGGCAGCGGCTTCCCGGCGACGGTGCACGCG
CTGCACCGGGGCGACGCGCTCAAGGACGAGGAGGGCCTCACCAACGTCTCGCGCCTGGTC
GAGAGGATGACGGACATGATCGAACTGCTCGACGAACACCGTCGGCTCACCGGCCGTTCG
GACGTGCTGGCCTCCAACGAGGTCAACGAGCGGGTCGGCCTCGCGCTCAACGAACTCCAG
GCACAGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005025 NADPH-dependent FMN reductase (Domain)
 [6-153]  8.89999999999994e-23 PF03358
PF03358   FMN_red
SignalP No significant hit
TMHMM No significant hit