close all open/close all

CDS information : C1027_00200


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction24,697 / 23,561 / - [in whole cluster]
24,697 / 23,561 / - [in contig]
Locationcomplement(23561..24697) [in whole cluster]
complement(23561..24697) [in contig]
TypeCDS
Length1,137 bp (378 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative acyltransferase
Product (GenBank)3-O-acyltransferase
GenesgcD6
Gene (GenBank)
EC number
Keyword
  • benzoxazolinate
Note
Note (GenBank)
  • ORF13
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[18182490] Biosynthesis of the enediyne antitumor antibiotic C-1027 involves a new branching point in chorismate metabolism. (Proc Natl Acad Sci U S A. , 2008)
Family/Domain
FD
IPR002656

close this sectionSequence

selected fasta
>putative acyltransferase [3-O-acyltransferase]
MPSPFFALSGMMLYKPYARVTISGTKRPATGRFLKRRALRILPAYYLLLVFAIPGYNWFE
IDSVSDVLRPVLLMHFYLPEGQPMHGIEPTWTVPAEFTFYLALPLIAWIGHRLARGGSTP
GQKARRLLLPLAALEVMAIGWVTYTNLPSTGATMQWYWPPYYAGCFAAGMALAIYSAYAE
ATPGTPGFYRFVIRRPLICWVPLIPLYLLYATKPIGIPGMGDNAALAQELVDHFILTSFT
LLLLAPMTVPGAESRFSDALFTSKPILFLGQISLGVYLWHEIVINLWLRNGSIFGKSPVP
TPEFRGDMGFWELFLFTISISVVLATISFYLVEKPLIRFGERGGPPRGGLPPAPAEPALR
LPDQRRPDSSPEPTAERT
selected fasta
>putative acyltransferase [3-O-acyltransferase]
ATGCCTTCCCCCTTCTTCGCTCTGTCCGGAATGATGCTGTACAAGCCCTACGCCCGCGTC
ACCATCAGTGGGACGAAGCGGCCCGCCACCGGACGGTTCCTCAAACGCCGGGCCCTGCGC
ATCCTGCCCGCCTACTACCTGTTGCTCGTCTTCGCAATCCCCGGCTACAACTGGTTCGAG
ATCGACAGCGTCAGCGACGTCCTGCGGCCCGTGCTGCTCATGCACTTCTATCTGCCCGAG
GGCCAGCCGATGCACGGCATCGAGCCCACCTGGACGGTCCCCGCCGAGTTCACGTTCTAC
CTCGCCCTGCCGCTGATCGCCTGGATCGGCCACCGGCTCGCGCGGGGCGGCAGCACTCCC
GGGCAGAAGGCACGCCGCCTCCTGCTGCCGCTGGCCGCGCTGGAAGTCATGGCCATCGGC
TGGGTCACGTACACCAACCTCCCCTCCACCGGCGCGACGATGCAGTGGTACTGGCCGCCC
TACTACGCCGGCTGCTTCGCCGCGGGCATGGCACTGGCCATCTACTCCGCGTACGCCGAG
GCGACGCCAGGGACCCCGGGCTTCTACCGTTTCGTGATCCGGCGCCCGCTGATCTGCTGG
GTCCCGCTCATCCCGCTGTACCTCCTCTACGCCACCAAGCCCATCGGCATCCCGGGCATG
GGCGACAACGCGGCCCTGGCCCAGGAGCTCGTCGACCACTTCATCCTGACCTCCTTCACC
CTGCTGCTCCTGGCACCGATGACGGTCCCCGGCGCCGAGTCCCGGTTCTCGGACGCGCTC
TTCACCAGCAAGCCGATCCTCTTCCTCGGCCAGATCTCCCTCGGCGTCTACCTCTGGCAC
GAGATCGTGATCAACCTCTGGCTCAGGAACGGCAGCATCTTCGGCAAGTCTCCCGTGCCA
ACGCCGGAATTCCGGGGTGACATGGGGTTCTGGGAACTGTTCCTCTTCACGATCTCGATC
AGCGTCGTGCTGGCGACCATCAGCTTCTATCTCGTCGAGAAGCCCCTCATCCGGTTCGGC
GAGCGTGGCGGCCCGCCGCGGGGCGGTCTTCCTCCCGCCCCCGCCGAGCCGGCCCTGCGG
CTCCCGGACCAGCGGCGGCCAGACAGTTCCCCCGAGCCGACCGCCGAGCGCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002656 Acyltransferase 3 (Domain)
 [5-327]  4.29999999999998e-18 PF01757
PF01757   Acyl_transf_3
SignalP No significant hit
TMHMM
 [39-61]  Transmembrane (i-o) [92-114]  Transmembrane (o-i) [127-144]  Transmembrane (i-o) [154-176]  Transmembrane (o-i) [197-219]  Transmembrane (i-o) [234-253]  Transmembrane (o-i) [266-288]  Transmembrane (i-o) [310-332]  Transmembrane (o-i)
Transmembrane 8