close all open/close all

CDS information : C1027_00210


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction25,559 / 24,981 / - [in whole cluster]
25,559 / 24,981 / - [in contig]
Locationcomplement(24981..25559) [in whole cluster]
complement(24981..25559) [in contig]
TypeCDS
Length579 bp (192 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose epimerase
Product (GenBank)dNTP-4-keto-6-deoxyglucose epimerase
GenesgcA2
Gene (GenBank)
EC number5.1.3.-
Keyword
  • deoxy aminosugar
Note
Note (GenBank)
  • ORF12
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
Q331R1
PmId
[15049360] Cloning, expression, and biological function of a dTDP-deoxyglucose epimerase (gerF) gene from Streptomyces sp. GERI-155. (Biotechnol Lett. , 2004)
[17053005] Biosynthesis of dTDP-6-deoxy-beta-D-allose, biochemical characterization of dTDP-4-keto-6-deoxyglucose reductase (GerKI) from Streptomyces sp. KCTC 0041BP. (Glycobiology. , 2007)
ACC
Q5SFD1
NITE
Chalc_00130
PmId
[23116432] Structural and functional studies on a 3'-epimerase involved in the biosynthesis of dTDP-6-deoxy-D-allose. (Biochemistry. , 2012)

close this sectionSequence

selected fasta
>putative NDP-hexose epimerase [dNTP-4-keto-6-deoxyglucose epimerase]
MKPIGISGAWTEEKQVFRDERGSFREWFQGEPFRRTVGHSFDLRQANCAISSHGVLRGIH
FAGGVPGQAKYFSCLRGSVFGAVVDIRVGSPTFGGWRTVELGEENGRALYVSAGLGFGFL
TLSDEAVIVYLCSAAYDPRLEHGLNPLDPEVGIAWPPEITPILSERDSSAPGLAEAGRRG
WLPSHSGRNKSS
selected fasta
>putative NDP-hexose epimerase [dNTP-4-keto-6-deoxyglucose epimerase]
ATGAAGCCGATCGGGATCTCGGGAGCGTGGACGGAGGAGAAGCAGGTCTTCCGTGACGAA
CGGGGCTCGTTTCGCGAGTGGTTCCAGGGCGAGCCCTTCCGCCGCACCGTAGGCCACTCC
TTCGACCTGCGGCAGGCGAACTGCGCGATCTCCTCCCACGGGGTGCTGCGGGGCATCCAC
TTCGCCGGGGGCGTACCCGGCCAGGCCAAGTACTTCAGCTGCCTGCGCGGCAGCGTGTTC
GGCGCCGTGGTCGACATCCGGGTGGGGTCGCCCACCTTCGGCGGCTGGCGGACCGTGGAG
CTCGGCGAGGAGAACGGACGGGCGCTGTACGTCTCCGCGGGGCTGGGCTTCGGATTCCTC
ACGCTGAGCGACGAGGCGGTGATCGTCTACCTGTGCTCGGCGGCCTACGACCCCCGGCTC
GAACATGGCTTGAATCCGCTGGATCCGGAGGTGGGCATCGCCTGGCCGCCGGAGATCACT
CCGATCCTCTCGGAACGGGACTCCTCGGCCCCCGGTCTGGCCGAGGCGGGGCGGCGGGGG
TGGCTGCCTTCCCACTCAGGCCGAAACAAGTCGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [6-176]  PD001462
PD001462   dTDP_sugar_isom
 [3-175]  2.4e-55 PF00908
PF00908   dTDP_sugar_isom
IPR011051 RmlC-like cupin domain (Domain)
 [1-180]  2.1000026783403e-64 SSF51182
SSF51182   RmlC_like_cupin
IPR014710 RmlC-like jelly roll fold (Domain)
 [3-182]  1.29999999999998e-59 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP No significant hit
TMHMM No significant hit