close all open/close all

CDS information : C1027_00220


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction25,810 / 27,165 / + [in whole cluster]
25,810 / 27,165 / + [in contig]
Location25810..27165 [in whole cluster]
25810..27165 [in contig]
TypeCDS
Length1,356 bp (451 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative monooxygenase
Product (GenBank)squalene monooxygenase-like protein
GenesgcD2
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF20
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
B5M9L6
NITE
Lasal_00200
PmId
[22506807] Sequential enzymatic epoxidation involved in polyether lasalocid biosynthesis. (J Am Chem Soc. , 2012)
[23796908] Biosynthetic machinery of ionophore polyether lasalocid: enzymatic construction of polyether skeleton. (Curr Opin Chem Biol. , 2013)
ACC
B5M9L6
NITE
Lasal2_00240
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
ACC
Q846W9
NITE
Monen_00220
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionSequence

selected fasta
>putative monooxygenase [squalene monooxygenase-like protein]
MTKHARDRAVVLGAGMAGLLAARVLSETYKEVLVIDRDRLGGTEQRRGVPHGRHAHALLA
KGQQILNELFPGLDTELTSAGIPAGDIAGNLRWYFNGRRLQPFDTGLISVSATRPELESH
VRARVAALPQVKIMDGCVIRGLTASADRSRVTGVEVVDESGTDTPTRLEADLVVDVTGRG
SRTPAWLEEFGYERPAEDRFKIDLAYTTRHFKLKEDPYGTDLSINPVASPSNPRGAFFPR
LADGSSQLSLTGILGDHPPTDDEGFLAFAKSLAAPEIYRAVRDAEPLDEPVTFRFPASVR
RRYERLRRFPGGFLVMGDGVCSFNPVYGQGMTVAALEAVALRDHLRDAPDPDALRFFRRI
STVIDVPWDIAAGADLNFPGVEGPRTMKVKMANAYMARLHAAAAVDGAVTGAFFRVAGLV
DPPQALMRPSLALRVMRNSSAKPSVPSGAAV
selected fasta
>putative monooxygenase [squalene monooxygenase-like protein]
ATGACCAAGCACGCCCGTGACCGCGCGGTAGTCCTCGGCGCAGGGATGGCGGGGCTGCTC
GCCGCGCGCGTCCTGTCCGAGACGTACAAGGAAGTGCTGGTGATCGACCGGGACCGGTTG
GGCGGCACGGAGCAGCGCCGCGGTGTCCCGCACGGACGCCACGCCCATGCGCTGCTGGCC
AAGGGACAGCAGATCCTCAACGAACTCTTCCCCGGACTCGACACCGAACTCACCTCGGCC
GGAATCCCCGCCGGGGACATCGCCGGGAACCTGCGGTGGTACTTCAACGGCCGCCGGCTC
CAGCCCTTCGACACCGGGCTGATCAGCGTCTCGGCGACGAGGCCCGAGCTGGAGTCCCAC
GTGCGCGCACGGGTCGCCGCGCTGCCACAGGTGAAGATCATGGACGGGTGCGTGATCCGG
GGCCTGACCGCCTCGGCCGACCGCAGCCGCGTCACCGGTGTCGAGGTGGTCGACGAGTCG
GGTACGGACACCCCGACGCGCCTGGAGGCCGACCTCGTCGTCGACGTCACGGGGCGCGGC
TCGCGGACTCCCGCCTGGCTGGAGGAGTTCGGATACGAGCGGCCCGCGGAGGACCGCTTC
AAGATCGATCTGGCGTACACCACGCGCCACTTCAAGCTCAAGGAAGACCCCTACGGCACG
GACCTGTCGATCAACCCGGTGGCATCGCCGAGCAACCCGCGCGGCGCGTTCTTCCCCCGG
CTCGCGGACGGCAGCTCCCAGCTCTCCCTCACCGGAATCCTCGGCGACCACCCGCCCACC
GACGACGAGGGCTTCCTGGCGTTCGCCAAGTCGCTTGCCGCGCCGGAGATCTACCGGGCC
GTCCGCGATGCCGAACCTCTCGACGAACCGGTCACCTTCCGCTTCCCGGCGAGCGTCCGC
CGCCGTTACGAGAGGCTGCGCCGTTTCCCCGGCGGGTTCCTCGTCATGGGCGACGGCGTG
TGCAGCTTCAACCCCGTCTACGGCCAGGGCATGACGGTCGCCGCCCTGGAGGCCGTGGCG
CTGCGGGACCACTTGCGCGACGCCCCGGACCCCGACGCCCTGCGCTTCTTCCGGCGTATC
TCCACGGTCATCGACGTTCCGTGGGACATCGCCGCCGGAGCGGATCTGAACTTCCCCGGG
GTGGAGGGCCCCCGCACCATGAAGGTGAAGATGGCCAACGCCTACATGGCCCGCCTGCAC
GCAGCGGCAGCCGTCGACGGCGCGGTGACCGGGGCGTTCTTCCGGGTGGCCGGGCTGGTG
GACCCCCCGCAGGCCCTGATGCGCCCCTCCCTCGCCCTGCGGGTCATGCGCAACTCCTCG
GCGAAGCCGTCGGTCCCTTCGGGCGCCGCCGTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit