close all open/close all

CDS information : C1027_00230


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction27,209 / 28,588 / + [in whole cluster]
27,209 / 28,588 / + [in contig]
Location27209..28588 [in whole cluster]
27209..28588 [in contig]
TypeCDS
Length1,380 bp (459 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)glycosyl transferase
GenesgcA6
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF19
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
Q9RPA2
NITE
Urd_00030
PmId
[10662691] Function of glycosyltransferase genes involved in urdamycin A biosynthesis. (Chem Biol. , 2000)
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)
ACC
Q9L555
NITE
Acla_00030
PmId
[15078101] AknK is an L-2-deoxyfucosyltransferase in the biosynthesis of the anthracycline aclacinomycin A. (Biochemistry. , 2004)
[17685523] Characterization of rhodosaminyl transfer by the AknS/AknT glycosylation complex and its use in reconstituting the biosynthetic pathway of aclacinomycin A. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>putative glycosyltransferase [glycosyl transferase]
MRVMITVFPARAHFLPLVPYAWALQSAGHEVCVVAPPGYPTGVADPDFHEAVTAAGLKSV
TCGQPQPLAVHDRDDPGYAAMLPTAAESERYVAALGISEKERPTWDVFYHFTLLAIRDYH
PPRPRQDVDQVIEFARIWQPDLVLWDAWFPSGAIAARVSGAAHARVLVAPDYTGWVTERF
AAAGPAAGADLLAETMRPLAERYGVEVDDDLLLGQWTVNPFPAPMNPPTRLTNVPVRYVP
YTGASVMPAWLYARPSRPRVALSLGVSARAFLKGDWGRTAKLLEAVAELDIEVIATLNDN
QLAESGPLPDNVHTLDYVPLDQLLPTCSAVIHHGSTGTFAAASAAGLPQVVCDTDEPLLL
FGEDTPDGIAWDFTCQKQLTATLTSRVVTDYGAGVRVDHQKQSAGQIREQLRRVLTEPSF
REGARRIREDRNSAPSPVELVSLLVELTKRHRRDKEADR
selected fasta
>putative glycosyltransferase [glycosyl transferase]
ATGCGGGTGATGATCACGGTGTTCCCGGCGCGGGCGCACTTCCTGCCGCTGGTGCCCTAT
GCCTGGGCCCTGCAGAGCGCGGGCCACGAGGTATGTGTCGTGGCGCCCCCGGGCTATCCC
ACCGGGGTGGCCGACCCCGACTTCCACGAGGCCGTCACCGCGGCCGGCCTGAAGTCGGTG
ACCTGCGGGCAGCCGCAGCCGCTGGCGGTCCACGACCGCGACGACCCCGGCTACGCGGCG
ATGCTGCCGACCGCGGCGGAGTCGGAGCGCTACGTGGCGGCCCTCGGGATCAGCGAGAAG
GAGCGCCCCACCTGGGACGTCTTCTACCACTTCACCTTGCTGGCGATCCGCGACTACCAT
CCGCCGCGGCCGCGGCAGGACGTGGACCAGGTGATCGAGTTCGCCCGGATCTGGCAGCCC
GATCTGGTGCTGTGGGACGCCTGGTTCCCCTCGGGCGCGATCGCGGCGCGGGTCAGCGGC
GCCGCGCACGCGCGGGTGCTCGTAGCCCCCGACTACACCGGCTGGGTCACCGAGCGGTTC
GCCGCCGCGGGCCCCGCGGCGGGGGCCGACCTCCTGGCCGAGACGATGCGGCCGCTGGCC
GAGCGGTACGGCGTGGAGGTCGACGACGATCTTCTGCTCGGACAGTGGACGGTCAATCCG
TTCCCGGCGCCGATGAACCCGCCGACCCGGCTCACGAACGTTCCGGTGCGCTACGTGCCC
TACACCGGTGCCAGCGTCATGCCCGCGTGGCTGTACGCGCGGCCGTCGCGGCCGCGGGTG
GCGCTGTCGCTCGGAGTGTCCGCGCGGGCGTTCCTCAAGGGTGACTGGGGGCGTACCGCC
AAACTGCTGGAAGCGGTCGCGGAGCTGGACATCGAGGTGATCGCCACGCTCAACGACAAC
CAACTGGCGGAGAGCGGGCCGCTGCCGGACAACGTCCACACCCTCGACTACGTACCGCTC
GACCAGTTGCTGCCCACCTGCTCGGCCGTCATCCACCACGGATCGACGGGCACCTTCGCC
GCGGCGAGCGCGGCCGGGCTGCCCCAGGTGGTCTGCGACACCGACGAGCCCCTCCTGCTC
TTCGGCGAGGACACCCCCGACGGCATCGCGTGGGACTTCACCTGCCAGAAGCAGCTCACC
GCGACGCTCACCTCCCGCGTGGTCACCGACTACGGGGCGGGGGTGCGCGTCGACCACCAG
AAGCAGTCCGCCGGACAGATCCGTGAGCAACTACGCAGGGTGCTCACCGAACCTTCCTTC
CGCGAGGGCGCTCGACGGATCCGGGAAGACCGGAATTCCGCCCCCAGCCCGGTCGAACTC
GTATCGCTCCTGGTAGAACTGACGAAGCGTCATCGCCGTGACAAGGAGGCGGACCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-43]  1.7e-07 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [218-313]  2.90000000000001e-30 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.494 Signal
Eukaryota   
TMHMM No significant hit