close all open/close all

CDS information : C1027_00240


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction28,585 / 29,583 / + [in whole cluster]
28,585 / 29,583 / + [in contig]
Location28585..29583 [in whole cluster]
28585..29583 [in contig]
TypeCDS
Length999 bp (332 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)dNTP-glucose dehydratase
GenesgcA
Gene (GenBank)
EC number4.2.1.46
Keyword
  • deoxy aminosugar
Note
Note (GenBank)
  • SgcA
Reference
ACC
PmId
[10639366] Genes for production of the enediyne antitumor antibiotic C-1027 in Streptomyces globisporus are clustered with the cagA gene that encodes the C-1027 apoprotein. (Antimicrob Agents Chemother. , 2000)
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
A8WEY5
PmId
[10650224] An efficient approach for cloning the dNDP-glucose synthase gene from actinomycetes and its application in Streptomyces spectabilis, a spectinomycin producer. (FEMS Microbiol Lett. , 2000)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [dNTP-glucose dehydratase]
MRMLVTGGAGFIGSQFVRATLHGELPGSEDARVTVLDKLTYSGNPANLTSVAAHPRYTFV
QGDTVDPRVVDEVVAGHDVIVHFAAESHVDRSIDTATRFVTTNVLGTQTLLEAALRHGVG
RFVHVSTDEVYGSIASGSWTEDTPLAPNVPYAASKAGSDLMALAWHRTRGLDVVVTRCTN
NYGPYQYPEKVIPLFVTNILDGLRVPLYGDGAHRRDWLHVSDHCRAIQMVMNSGRAGEVY
HIGGGTELSNEELTGLLLTACGTDWSCVDRVADRQGHDRRYSLDITKIRQELGYEPLVAF
EDGLAATVKWYHENRSWWQPLKEAAGLLDAVG
selected fasta
>putative dTDP-glucose 4,6-dehydratase [dNTP-glucose dehydratase]
ATGAGGATGCTGGTGACGGGCGGAGCGGGTTTCATCGGCTCGCAGTTCGTGCGGGCCACA
CTGCACGGCGAGCTGCCGGGTTCCGAGGACGCCCGGGTGACGGTCCTGGACAAGCTGACG
TACTCCGGCAATCCGGCCAACCTCACCTCCGTCGCGGCCCATCCGCGGTACACCTTCGTC
CAGGGCGACACCGTCGACCCGCGCGTCGTCGACGAGGTGGTCGCCGGCCACGACGTCATC
GTCCACTTCGCGGCGGAGTCGCACGTGGACCGCTCGATCGACACCGCCACCCGGTTCGTC
ACGACCAACGTGCTCGGGACCCAGACGCTGCTGGAAGCGGCTCTCCGGCACGGGGTCGGC
CGGTTCGTGCACGTGTCGACCGACGAGGTCTACGGGTCGATCGCCTCCGGCTCATGGACC
GAGGACACCCCGCTCGCCCCCAACGTCCCCTACGCGGCGTCGAAGGCGGGTTCGGACCTG
ATGGCGCTCGCCTGGCACCGCACCCGGGGCCTGGACGTCGTCGTCACCCGGTGCACCAAC
AACTACGGTCCCTACCAGTACCCCGAGAAGGTGATCCCGCTCTTCGTCACCAACATCCTC
GACGGCTTGCGGGTGCCCCTGTACGGGGACGGCGCCCACCGCCGGGACTGGCTGCACGTG
TCCGACCACTGCCGGGCCATCCAGATGGTCATGAACTCCGGCCGGGCCGGGGAGGTCTAC
CACATCGGCGGCGGCACCGAACTCTCCAACGAGGAACTCACCGGCCTGTTGCTCACGGCG
TGCGGCACCGACTGGTCCTGCGTGGACCGGGTGGCCGACCGGCAGGGGCACGACCGCCGC
TACTCGCTCGACATCACGAAGATCCGGCAGGAACTGGGCTACGAGCCCCTGGTCGCCTTC
GAGGACGGCCTGGCCGCGACGGTGAAGTGGTACCACGAGAACCGTTCGTGGTGGCAGCCG
CTGAAGGAAGCGGCCGGCCTCCTGGACGCCGTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [3-243]  2.39999999999997e-65 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [2-321]  1.60000000000002e-129 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-199]  3.2e-64 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit