close all open/close all

CDS information : C1027_00250


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction29,627 / 31,192 / + [in whole cluster]
29,627 / 31,192 / + [in contig]
Location29627..31192 [in whole cluster]
29627..31192 [in contig]
TypeCDS
Length1,566 bp (521 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)transmembrane efflux protein
GenesgcB
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • SgcB
Reference
ACC
PmId
[10639366] Genes for production of the enediyne antitumor antibiotic C-1027 in Streptomyces globisporus are clustered with the cagA gene that encodes the C-1027 apoprotein. (Antimicrob Agents Chemother. , 2000)
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
Related Reference
ACC
Q939A4
PmId
[12937892] Repressed multidrug resistance genes in Streptomyces lividans. (Arch Microbiol. , 2003)
ACC
A5H8A5
PmId
[17470656] Transferable resistance to aminoglycosides by methylation of G1405 in 16S rRNA and to hydrophilic fluoroquinolones by QepA-mediated efflux in Escherichia coli. (Antimicrob Agents Chemother. , 2007)
[17548499] New plasmid-mediated fluoroquinolone efflux pump, QepA, found in an Escherichia coli clinical isolate. (Antimicrob Agents Chemother. , 2007)

close this sectionSequence

selected fasta
>putative drug resistance transporter [transmembrane efflux protein]
MTAVKEPTSRAGRREWIALVVLSLPTMLLMLDINVLMLALPQLSEDLGASSTQQLWITDI
YGFAIAGFLVTMGTLGDRIGRRRLLLGGAAVFAVVSVVAAFSDSAAMLVVSRAVLGVAGA
TVMPSTLALISNMFEDPKERGTAIAMWASAMMAGVALGPAVGGLVLAAFWWGSVFLIAVP
VMLLVVVTGPVLLTESRDPDAGRLDLLSAGLSLATVLPVIYGLKELARTGWDPLAAGAVV
LGVIFGALFVQRQRRLADPMLDLGLFADRTLRAGLTVSLVNAVIMGGTGLMVALYLQTIA
GHSPLAAGLWLLIPACMLVVGVQLSNLLAQRMPPSRVLLGGLLIAAVGQLLITQVDTEDT
ALLIAATTLIYFGASPVGPITTGAIMGAAPPEKAGAASSLSATGGEFGVALGIAGLGSLG
TVVYSAGVEVPDAAGPADADAAQESIAGALHTAGQLAPGSADALLDSARAAFTSGVQSVA
AVCAVFSLALAVLIGTRLRDISAMDHGHGEEPAENDAQPAT
selected fasta
>putative drug resistance transporter [transmembrane efflux protein]
GTGACAGCAGTCAAGGAGCCGACGTCCCGCGCAGGACGGCGGGAGTGGATCGCTCTCGTC
GTCCTCTCCTTGCCCACGATGCTGTTGATGCTGGACATCAACGTCCTCATGCTGGCCTTG
CCGCAGTTGAGCGAGGATCTCGGCGCGAGCAGCACGCAACAGCTGTGGATCACCGACATC
TACGGATTCGCGATCGCCGGCTTCCTGGTGACCATGGGCACCCTCGGCGACCGGATCGGC
CGCCGCAGGCTCCTGCTCGGGGGCGCGGCCGTCTTCGCGGTCGTGTCCGTCGTCGCCGCG
TTCTCCGACAGCGCGGCGATGCTCGTCGTCAGCCGCGCCGTGCTCGGCGTCGCCGGGGCC
ACGGTGATGCCCTCGACGCTCGCGCTCATCAGCAACATGTTCGAGGACCCCAAGGAGCGG
GGCACCGCCATCGCCATGTGGGCGAGCGCCATGATGGCCGGAGTCGCCCTCGGGCCCGCC
GTCGGCGGCCTGGTCCTCGCCGCGTTCTGGTGGGGATCGGTGTTCCTCATCGCCGTTCCG
GTGATGCTGCTGGTGGTGGTCACCGGCCCCGTGCTGCTCACCGAGTCCCGCGACCCGGAC
GCCGGACGGCTGGACCTGCTGAGCGCGGGGCTCTCCCTCGCGACCGTGCTGCCGGTGATC
TACGGACTGAAGGAGCTGGCCCGGACCGGGTGGGACCCGCTCGCCGCCGGCGCGGTGGTC
CTCGGCGTGATCTTCGGCGCGCTGTTCGTCCAGCGCCAGCGGCGGTTGGCCGACCCCATG
CTGGACCTCGGCCTCTTCGCCGACCGCACCCTGCGGGCGGGTCTGACGGTCAGTCTGGTC
AACGCCGTCATCATGGGCGGGACCGGACTGATGGTCGCCCTGTACCTCCAGACGATCGCC
GGTCACTCCCCGTTGGCCGCCGGGCTGTGGCTGCTGATCCCGGCCTGCATGCTCGTCGTG
GGCGTACAGCTGTCGAACCTGCTGGCCCAGCGGATGCCCCCTTCCCGGGTGCTGCTGGGG
GGACTGCTGATCGCGGCCGTCGGACAGCTCCTGATCACCCAGGTGGACACCGAGGACACC
GCCCTCCTCATCGCGGCCACCACCCTGATCTACTTCGGCGCCTCACCGGTGGGGCCGATC
ACCACGGGCGCGATCATGGGAGCCGCGCCCCCGGAGAAGGCGGGTGCCGCCTCGTCGCTG
TCCGCCACCGGCGGCGAGTTCGGAGTGGCGCTCGGCATCGCGGGCCTGGGGAGTCTGGGC
ACCGTCGTGTACAGCGCCGGGGTCGAGGTGCCGGACGCGGCCGGGCCCGCCGACGCCGAC
GCCGCGCAGGAGAGCATCGCCGGCGCCCTGCACACGGCCGGTCAGCTGGCACCGGGCAGC
GCCGACGCCCTGCTGGACTCCGCGCGCGCGGCCTTCACCAGCGGCGTGCAGTCCGTCGCC
GCCGTCTGCGCCGTGTTCTCCCTGGCGCTCGCCGTCCTCATCGGCACCCGGCTGCGGGAC
ATTTCCGCGATGGACCACGGGCACGGCGAGGAACCGGCCGAGAACGACGCTCAACCGGCC
ACATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [26-412]  2.4e-45 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-516]  1.90000694315261e-72 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [18-499]  PS50850
PS50850   MFS
SignalP No significant hit
TMHMM
 [17-39]  Transmembrane (i-o) [54-76]  Transmembrane (o-i) [83-105]  Transmembrane (i-o) [109-131]  Transmembrane (o-i) [144-166]  Transmembrane (i-o) [171-193]  Transmembrane (o-i) [206-223]  Transmembrane (i-o) [233-250]  Transmembrane (o-i) [274-296]  Transmembrane (i-o) [306-328]  Transmembrane (o-i) [335-353]  Transmembrane (i-o) [363-385]  Transmembrane (o-i) [406-428]  Transmembrane (i-o) [473-495]  Transmembrane (o-i)
Transmembrane 14