close all open/close all

CDS information : C1027_00260


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction31,275 / 32,585 / + [in whole cluster]
31,275 / 32,585 / + [in contig]
Location31275..32585 [in whole cluster]
31275..32585 [in contig]
TypeCDS
Length1,311 bp (436 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative ligase
Product (GenBank)coenzyme F390 synthase-like protein
GenesgcH
Gene (GenBank)
EC number
Keyword
  • benzoxazolinate
Note
Note (GenBank)
  • ORF3
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[18182490] Biosynthesis of the enediyne antitumor antibiotic C-1027 involves a new branching point in chorismate metabolism. (Proc Natl Acad Sci U S A. , 2008)
Related Reference
ACC
O33469
PmId
[8969218] Molecular cloning and expression in different microbes of the DNA encoding Pseudomonas putida U phenylacetyl-CoA ligase. Use of this gene to improve the rate of benzylpenicillin biosynthesis in Penicillium chrysogenum. (J Biol Chem. , 1996)
Family/Domain
FD
IPR000873

close this sectionSequence

selected fasta
>putative ligase [coenzyme F390 synthase-like protein]
MEYWNSTAETMPRQELEQWKWRRLQAAMDHARRLSPFWRERLPENITSMADYAARVPLLR
KADLLAAEAASPPYGTWPSLDPALGVRHHQTSGTSGNPPIRTFDTERDWAWCVDTFCTAL
HSMGVRPHHKGLVAFGYGLFAGFWGMHYGLERMGATVIPAGGLDSRSRVRLLVDYQIEVL
GLTPSYAMRLIETAREMGIDLAREANVQIILAGAEPRSAFTTRTIEEAFGARVFNAAGTT
EFGGVFMFECTARREACHIIEPSCIEEVLDPVTEQPVGYGEEGVRVTTGLNREGMQLFRH
WTEDVVVKRPHTECGCGRTWDFYDGGILRRVDDMRKIRGVSITPVMIEDVLRGFDEVNEF
HSSIRTVRGLDTIHVKVEAGDISGEAAESLCGRITEEFKREIGIRPQVELTPAGSLPRSK
WKAARLHDERELAPQA
selected fasta
>putative ligase [coenzyme F390 synthase-like protein]
GTGGAGTACTGGAACAGCACGGCGGAGACCATGCCCCGCCAGGAACTCGAACAGTGGAAG
TGGCGCAGGCTCCAGGCCGCCATGGACCACGCCAGAAGGCTTTCGCCCTTCTGGCGGGAA
CGACTCCCCGAGAACATCACCTCCATGGCGGACTACGCGGCGCGGGTGCCTCTCCTGCGC
AAGGCCGACCTCCTCGCCGCGGAAGCCGCGTCTCCCCCTTACGGCACCTGGCCCTCGCTG
GATCCGGCGCTCGGAGTGCGCCATCACCAGACCAGCGGCACCAGCGGTAACCCCCCCATC
CGGACGTTCGACACCGAACGCGACTGGGCCTGGTGCGTGGACACGTTCTGCACGGCGCTC
CACAGCATGGGCGTGCGCCCGCACCACAAGGGTCTGGTGGCGTTCGGCTACGGGCTGTTC
GCCGGTTTCTGGGGCATGCACTACGGCCTCGAGCGCATGGGCGCCACGGTCATCCCGGCC
GGCGGCCTCGACTCCCGCTCCCGGGTACGGCTGCTGGTCGACTACCAGATCGAGGTGCTC
GGCCTCACACCGAGCTATGCGATGCGGCTGATCGAGACGGCCCGCGAGATGGGCATCGAC
CTCGCCCGCGAGGCTAACGTCCAGATCATCCTGGCCGGGGCGGAGCCGCGCTCCGCGTTC
ACCACCCGCACCATCGAGGAGGCCTTCGGCGCCCGGGTCTTCAACGCCGCGGGCACCACT
GAGTTCGGGGGGGTGTTCATGTTCGAGTGCACCGCCCGGCGCGAGGCCTGCCACATCATC
GAACCCTCGTGCATCGAGGAGGTGCTCGACCCGGTGACGGAACAGCCCGTCGGCTACGGC
GAGGAGGGCGTCCGAGTCACCACCGGGCTGAACCGTGAGGGGATGCAGCTCTTCCGGCAC
TGGACCGAGGACGTCGTGGTCAAGCGGCCCCACACCGAGTGCGGCTGCGGCCGGACGTGG
GACTTCTACGACGGCGGCATCCTTCGGCGCGTGGACGACATGCGCAAGATACGCGGGGTC
TCGATCACCCCGGTGATGATCGAGGATGTGCTGCGCGGCTTCGACGAGGTGAACGAGTTC
CACTCGTCCATCCGGACCGTCCGCGGACTCGATACGATCCACGTCAAGGTCGAGGCGGGA
GACATCTCGGGTGAGGCGGCCGAGAGCCTGTGCGGCCGCATCACCGAGGAGTTCAAGCGT
GAGATAGGCATACGGCCCCAGGTGGAGCTGACCCCCGCGGGCAGCCTCCCCCGATCGAAG
TGGAAGGCGGCACGACTTCATGACGAGCGCGAACTCGCCCCTCAGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [90-359]  4.40000000000001e-15 PF00501
PF00501   AMP-binding
SignalP No significant hit
TMHMM No significant hit