close all open/close all

CDS information : C1027_00270


close this sectionLocation

Organism
StrainC-1027
Entry nameC-1027
Contig
Start / Stop / Direction32,804 / 34,387 / + [in whole cluster]
32,804 / 34,387 / + [in contig]
Location32804..34387 [in whole cluster]
32804..34387 [in contig]
TypeCDS
Length1,584 bp (527 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
ProductFADH2-dependent (S)-3-chloro-beta-tyrosyl-PCP monooxygenase
Product (GenBank)chlorophenol-4-monooxygenase
GenesgcC
Gene (GenBank)
EC number
Keyword
  • two-component system
  • (S)-3-chloro-4,5-dihydroxy-beta-phenylalanine
Note
Note (GenBank)
  • ORF4
Reference
ACC
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[16104723] Biosynthesis of the beta-amino acid moiety of the enediyne antitumor antibiotic C-1027 featuring beta-amino acyl-S-carrier protein intermediates. (J Am Chem Soc. , 2005)
[18426211] Characterization of the two-component, FAD-dependent monooxygenase SgcC that requires carrier protein-tethered substrates for the biosynthesis of the enediyne antitumor antibiotic C-1027. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>FADH2-dependent (S)-3-chloro-beta-tyrosyl-PCP monooxygenase [chlorophenol-4-monooxygenase]
MPHGAEREASPAEESAGTRPLTGEEYLESLRDAREVYLDGSRVKDVTAHPAFHNPARMTA
RLYDSLHDPAQKAVLTAPTDAGDGFTHRFFTAPRSVDDLVKDQAAIASWARKSYGWMGRS
PDYKASFLGTLGANADFYEPFADNARRWYRESQEKVLYWNHAFLHPPVDRSLPADEVGDV
FIHVERETDAGLVVSGAKVVATGSALTHAAFISHWGLPIKDRKFALVATVPMDADGLKVI
CRPSYSANAATTGSPFDNPLSSRLDENDAILVLDQVLIPWENVFVYGNLGKVHLLAGQSG
MIERATFHGCTRLAVKLEFIAGLLAKALDITGAKDFRGVQTRLGEVLAWRNLFWSLSDAA
ARNPVPWKNGTLLPNPQAGMAYRWFMQIGYPRVLEIVQQDVASGLMYVNSSTEDFRNPET
GPYLEKYLRGSDGAGAVERVKVMKLLWDAVGSDFGGRHELYERNYSGNHENTRIELLLSQ
TASGKLDSYMDFAQACMDEYDLDGWTAPDLESFHAMRSASRDLLGGL
selected fasta
>FADH2-dependent (S)-3-chloro-beta-tyrosyl-PCP monooxygenase [chlorophenol-4-monooxygenase]
GTGCCCCACGGTGCAGAGCGCGAAGCGAGCCCGGCCGAGGAGAGCGCCGGCACCCGGCCG
CTGACCGGCGAGGAGTATCTGGAGAGCCTGCGGGACGCGCGGGAGGTGTACCTCGACGGC
AGCCGCGTCAAGGACGTCACCGCGCATCCCGCGTTCCACAACCCGGCCCGGATGACGGCC
CGGCTGTACGACAGCCTGCACGACCCCGCCCAGAAAGCGGTCCTGACGGCGCCCACCGAT
GCCGGTGACGGTTTCACCCACCGCTTCTTCACCGCACCGCGCAGCGTCGACGACCTGGTC
AAGGACCAGGCCGCCATCGCATCCTGGGCGCGCAAGAGCTACGGCTGGATGGGGCGCAGC
CCCGACTACAAGGCGTCGTTCCTCGGCACGCTGGGGGCCAACGCCGACTTCTACGAGCCC
TTCGCGGACAACGCCCGGCGCTGGTACCGGGAGTCGCAGGAGAAGGTGCTGTACTGGAAC
CATGCCTTCCTTCACCCGCCGGTCGACCGCTCGCTGCCCGCCGACGAGGTGGGCGACGTC
TTCATCCACGTCGAGCGGGAGACCGACGCGGGCCTGGTGGTGAGCGGGGCCAAGGTCGTC
GCGACCGGATCGGCCCTCACCCACGCGGCGTTCATCTCGCACTGGGGACTTCCCATCAAG
GACCGGAAGTTCGCCCTGGTGGCCACCGTGCCGATGGACGCGGACGGCCTCAAGGTGATC
TGCCGTCCCTCCTACTCCGCAAACGCGGCGACCACGGGCAGCCCGTTCGACAACCCGCTG
TCCTCACGGCTGGACGAGAACGACGCCATCCTCGTACTCGACCAGGTGCTGATCCCCTGG
GAGAACGTGTTCGTCTACGGCAACCTGGGCAAGGTACATCTCCTCGCCGGACAGTCCGGG
ATGATCGAACGCGCCACCTTCCACGGGTGCACCCGGCTCGCCGTGAAGCTGGAGTTCATC
GCCGGGCTGCTGGCCAAGGCGCTGGACATCACCGGGGCGAAGGACTTCCGCGGTGTGCAG
ACCCGGCTCGGAGAAGTCCTGGCCTGGCGCAACCTCTTCTGGTCACTGTCGGACGCGGCG
GCCCGCAACCCCGTCCCCTGGAAGAACGGCACGCTCCTGCCCAACCCTCAGGCGGGTATG
GCCTACCGCTGGTTCATGCAGATCGGCTACCCGCGGGTCCTGGAGATCGTCCAACAGGAC
GTGGCCAGCGGCCTCATGTACGTCAACTCCTCCACGGAGGACTTCCGCAACCCCGAGACC
GGCCCCTACTTGGAGAAGTACCTCCGGGGCAGCGACGGCGCAGGCGCCGTCGAGCGTGTC
AAGGTGATGAAGCTGCTGTGGGACGCGGTGGGATCCGACTTCGGCGGCCGGCACGAACTC
TACGAGCGGAACTACTCCGGGAACCACGAGAACACCCGGATCGAGTTGCTGCTGTCGCAG
ACGGCGAGCGGCAAACTGGACTCGTACATGGACTTCGCCCAGGCATGCATGGACGAGTAC
GACCTGGACGGCTGGACCGCTCCCGACCTGGAGTCGTTTCACGCGATGCGTTCCGCCTCC
CGCGACCTTCTCGGAGGGCTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004925 HpaB/PvcC/4-BUDH (Family)
 [1-513]  PIRSF000331
PIRSF000331   HpaA_HpaB
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [158-282]  9.50000000000005e-47 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [276-500]  6.39998633403535e-59 SSF47203
SSF47203   AcylCoADH_C_like
 [283-479]  5.40000000000002e-43 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [19-286]  2.19999900980707e-80 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR024674 HpaB/PvcC/4-BUDH N-terminal (Domain)
 [22-285]  1.10000000000001e-102 PF11794
PF11794   HpaB_N
IPR024677 4-HPA 3-monooxygenase large component/Pyoverdin chromophore biosynthetic protein (Family)
 [1-524]  PIRSF500125
PIRSF500125   4_HPA_large
IPR024719 HpaB/PvcC/4-BUDH C-terminal (Domain)
 [294-494]  1e-73 PF03241
PF03241   HpaB
SignalP No significant hit
TMHMM No significant hit